Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2245
Gene name
LocationContig_208:1968..3080
Strand-
Gene length (bp)1112
Transcript length (bp)981
Coding sequence length (bp)981
Protein length (aa) 327

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08450 SGL SMP-30/Gluconolactonase/LRE-like region 1.5E-22 55 301

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q01578|GNL_ZYMMO Gluconolactonase OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=gnl PE=1 SV=2 131 305 2.0E-16

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup927
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7211
Ophiocordyceps australis map64 (Brazil) OphauB2|3857
Ophiocordyceps camponoti-floridani Ophcf2|00633
Ophiocordyceps camponoti-rufipedis Ophun1|2245 (this protein)
Ophiocordyceps kimflemingae Ophio5|4215
Ophiocordyceps kimflemingae Ophio5|7650
Ophiocordyceps subramaniannii Hirsu2|6563

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2245
MSLITHSAAAAAAMASNSTAEFQYVGVSARDILGDAPELKLLAEDNEPLFHEAGVYFPHDKSLFVTSNQLSGPDG
KTVQISRVALADGAAKVEPITTNITMANGGVNYGKGIVFCSQGDMKQPGGLVMMDVIDVKPVDGQHPSTMLVSQF
GSRPFNSPNDVVASGDGCLWFTDPHYGSEQGIRPPPELPAMVWRFNPATGSVRAMADGFGRPNGLTFSPDQKTLY
SFKVDSFNGEPSLSDRRLFAMCDKGIPDGIKTDTAGNVYSGCGDGINIWSPGGELMGKILVEGGAANFCFGDDGY
MFILNEKKLWMAKLAPGVKGALLNSK*
Coding >Ophun1|2245
ATGAGCCTCATAACTCACAGCGCCGCCGCCGCCGCCGCCATGGCGTCCAACTCGACGGCCGAGTTCCAGTACGTC
GGCGTCTCGGCCAGGGATATCTTGGGCGATGCCCCCGAGCTGAAGCTGCTGGCCGAGGACAACGAGCCGCTCTTC
CACGAGGCCGGCGTCTATTTCCCGCACGACAAGTCGCTGTTTGTCACGAGCAACCAACTCTCCGGGCCCGACGGC
AAGACGGTCCAGATAAGCCGCGTCGCGCTGGCTGACGGAGCGGCCAAGGTCGAGCCCATCACGACCAACATTACC
ATGGCCAACGGAGGCGTCAACTACGGAAAGGGCATCGTCTTCTGCTCCCAGGGCGACATGAAGCAGCCGGGCGGA
CTGGTCATGATGGACGTCATCGATGTCAAGCCCGTCGACGGCCAGCATCCTTCCACCATGTTGGTGAGCCAATTC
GGGAGCCGCCCCTTCAACTCGCCCAACGACGTCGTGGCGTCGGGTGACGGCTGTCTCTGGTTCACGGATCCTCAC
TACGGTTCCGAGCAGGGCATCCGGCCGCCGCCGGAACTGCCGGCCATGGTCTGGAGGTTTAATCCGGCCACCGGG
TCGGTGCGAGCCATGGCTGACGGCTTCGGACGGCCCAACGGCTTGACCTTTAGCCCTGATCAGAAGACGCTCTAC
TCCTTCAAGGTCGATTCCTTCAACGGCGAACCCTCGCTCTCGGACCGGCGGCTCTTTGCCATGTGCGACAAGGGC
ATCCCCGACGGCATCAAGACCGATACGGCCGGCAACGTCTACAGCGGCTGCGGCGACGGCATCAACATCTGGTCT
CCCGGCGGCGAGCTGATGGGCAAGATCCTGGTCGAGGGCGGAGCGGCCAACTTTTGCTTCGGCGACGATGGCTAC
ATGTTTATACTCAACGAGAAGAAGCTCTGGATGGCGAAGCTGGCTCCGGGCGTCAAGGGGGCTCTGCTGAATTCG
AAGTGA
Transcript >Ophun1|2245
ATGAGCCTCATAACTCACAGCGCCGCCGCCGCCGCCGCCATGGCGTCCAACTCGACGGCCGAGTTCCAGTACGTC
GGCGTCTCGGCCAGGGATATCTTGGGCGATGCCCCCGAGCTGAAGCTGCTGGCCGAGGACAACGAGCCGCTCTTC
CACGAGGCCGGCGTCTATTTCCCGCACGACAAGTCGCTGTTTGTCACGAGCAACCAACTCTCCGGGCCCGACGGC
AAGACGGTCCAGATAAGCCGCGTCGCGCTGGCTGACGGAGCGGCCAAGGTCGAGCCCATCACGACCAACATTACC
ATGGCCAACGGAGGCGTCAACTACGGAAAGGGCATCGTCTTCTGCTCCCAGGGCGACATGAAGCAGCCGGGCGGA
CTGGTCATGATGGACGTCATCGATGTCAAGCCCGTCGACGGCCAGCATCCTTCCACCATGTTGGTGAGCCAATTC
GGGAGCCGCCCCTTCAACTCGCCCAACGACGTCGTGGCGTCGGGTGACGGCTGTCTCTGGTTCACGGATCCTCAC
TACGGTTCCGAGCAGGGCATCCGGCCGCCGCCGGAACTGCCGGCCATGGTCTGGAGGTTTAATCCGGCCACCGGG
TCGGTGCGAGCCATGGCTGACGGCTTCGGACGGCCCAACGGCTTGACCTTTAGCCCTGATCAGAAGACGCTCTAC
TCCTTCAAGGTCGATTCCTTCAACGGCGAACCCTCGCTCTCGGACCGGCGGCTCTTTGCCATGTGCGACAAGGGC
ATCCCCGACGGCATCAAGACCGATACGGCCGGCAACGTCTACAGCGGCTGCGGCGACGGCATCAACATCTGGTCT
CCCGGCGGCGAGCTGATGGGCAAGATCCTGGTCGAGGGCGGAGCGGCCAACTTTTGCTTCGGCGACGATGGCTAC
ATGTTTATACTCAACGAGAAGAAGCTCTGGATGGCGAAGCTGGCTCCGGGCGTCAAGGGGGCTCTGCTGAATTCG
AAGTGA
Gene >Ophun1|2245
ATGAGCCTCATAACTCACAGCGCCGCCGCCGCCGCCGCCATGGCGTCCAACTCGACGGCCGAGTTCCAGTACGTC
GGCGTCTCGGCCAGGGATATCTTGGGCGATGCCCCCGAGCTGAAGCTGCTGGCCGAGGACAACGAGCCGCTCTTC
CACGAGGCCGGCGTCTATTTCCCGCACGACAAGTCGCTGTTTGTCACGAGCAACCAACTCTCCGGGCCCGACGGC
AAGACGGTCCAGATAAGCCGCGTCGCGCTGGCTGACGGAGCGGCCAAGGTCGAGCCCATCACGACCAACATTACC
ATGGCCAACGGAGGCGTCAACTACGGAAAGGGCATCGTCTTCTGCTCCCAGGGCGACATGAAGCAGCCGGGCGGA
CTGGTCATGATGGACGTCATCGATGTCAAGCCCGTCGACGGCCAGCATCCTTCCACCATGTTGGTGAGCCAATTC
GGGAGCCGCCCCTTCAACTCGCCCAACGACGTCGTGGCGTCGGGTGACGGCTGTCTCTGGTTCACGGATCCTCAC
TACGGTTCCGAGCAGGGCATCCGGCCGCCGCCGGAACTGCCGGCCATGGTCTGGAGGTTTAATCCGGCCACCGGG
TCGGTGCGAGCCATGGCTGACGGCTTCGGACGGCCCAACGGCTTGACCTTTAGCCCTGATCAGAAGACGCTGTAT
GTGACGGACACGGACCGCGTCCACGGTGACGGCGAGGATCCGAAACGGGCCTCTCACATGTAGGGAAACCAGCGT
TACATGTTGATTTGCAATGATGATACTGAGAACTGACCTCCCACTGTCACAGCTACTCCTTCAAGGTCGATTCCT
TCAACGGCGAACCCTCGCTCTCGGACCGGCGGCTCTTTGCCATGTGCGACAAGGGCATCCCCGACGGCATCAAGA
CCGATACGGCCGGCAACGTCTACAGCGGCTGCGGCGACGGCATCAACATCTGGTCTCCCGGCGGCGAGCTGATGG
GCAAGATCCTGGTCGAGGGCGGAGCGGCCAACTTTTGCTTCGGCGACGATGGCTACATGTTTATACTCAACGAGA
AGAAGCTCTGGATGGCGAAGCTGGCTCCGGGCGTCAAGGGGGCTCTGCTGAATTCGAAGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail