Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2239
Gene name
LocationContig_207:10505..16890
Strand-
Gene length (bp)6385
Transcript length (bp)6306
Coding sequence length (bp)6306
Protein length (aa) 2102

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08354 DUF1729 Domain of unknown function (DUF1729) 2.3E-159 738 1087
PF00698 Acyl_transf_1 Acyl transferase domain 2.1E-85 1692 2063
PF17951 FAS_meander Fatty acid synthase meander beta sheet domain 6.2E-51 1151 1294
PF17828 FAS_N N-terminal domain in fatty acid synthase subunit beta 5.8E-36 20 146
PF01575 MaoC_dehydratas MaoC like domain 1.5E-35 1550 1677
PF16073 SAT Starter unit:ACP transacylase in aflatoxin biosynthesis 2.0E-34 172 424
PF13452 MaoC_dehydrat_N N-terminal half of MaoC dehydratase 5.4E-25 1306 1428

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P34229|FAS1_YARLI Fatty acid synthase subunit beta OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=FAS1 PE=3 SV=2 8 2076 0.0E+00
sp|P34731|FAS1_CANAX Fatty acid synthase subunit beta OS=Candida albicans GN=FAS1 PE=3 SV=1 22 2076 0.0E+00
sp|P07149|FAS1_YEAST Fatty acid synthase subunit beta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FAS1 PE=1 SV=2 20 2078 0.0E+00
sp|Q92215|TOXC_COCCA Putative fatty acid synthase subunit TOXC OS=Cochliobolus carbonum GN=TOXC PE=3 SV=1 20 2080 0.0E+00
sp|Q9UUG0|FAS1_SCHPO Fatty acid synthase subunit beta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fas1 PE=1 SV=1 20 2076 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P34229|FAS1_YARLI Fatty acid synthase subunit beta OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=FAS1 PE=3 SV=2 8 2076 0.0E+00
sp|P34731|FAS1_CANAX Fatty acid synthase subunit beta OS=Candida albicans GN=FAS1 PE=3 SV=1 22 2076 0.0E+00
sp|P07149|FAS1_YEAST Fatty acid synthase subunit beta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FAS1 PE=1 SV=2 20 2078 0.0E+00
sp|Q92215|TOXC_COCCA Putative fatty acid synthase subunit TOXC OS=Cochliobolus carbonum GN=TOXC PE=3 SV=1 20 2080 0.0E+00
sp|Q9UUG0|FAS1_SCHPO Fatty acid synthase subunit beta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fas1 PE=1 SV=1 20 2076 0.0E+00
sp|Q00706|STCK_EMENI Putative sterigmatocystin biosynthesis fatty acid synthase subunit beta OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcK PE=3 SV=2 156 2063 0.0E+00
sp|Q54TW0|PKS18_DICDI Probable polyketide synthase 18 OS=Dictyostelium discoideum GN=pks18 PE=2 SV=1 1687 1890 1.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0004318 enoyl-[acyl-carrier-protein] reductase (NADH) activity Yes
GO:0004317 3-hydroxypalmitoyl-[acyl-carrier-protein] dehydratase activity Yes
GO:0016627 oxidoreductase activity, acting on the CH-CH group of donors No
GO:0019171 3-hydroxyacyl-[acyl-carrier-protein] dehydratase activity No
GO:0016747 acyltransferase activity, transferring groups other than amino-acyl groups No
GO:0016835 carbon-oxygen lyase activity No
GO:0003674 molecular_function No
GO:0016740 transferase activity No
GO:0003824 catalytic activity No
GO:0016628 oxidoreductase activity, acting on the CH-CH group of donors, NAD or NADP as acceptor No
GO:0016836 hydro-lyase activity No
GO:0016491 oxidoreductase activity No
GO:0016829 lyase activity No
GO:0016746 acyltransferase activity No
GO:0004312 fatty acid synthase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2239
MYGTATGPQTGISTPRSSASLRPLTITHGSLETSFLVPSNLHFHASQLKDRLIATLPEATDELAHDDEPSSVAEL
VARYLGLVAREVENGEDDAQGSYEEVLKLVLNEFERAFLRGNEVHAVAAALPGIEAKKLEVIRSYYLARAVAERT
IKPHQSALLRAADDGSAEIYTIFGGQGNIEQYFEELREVFQTYPSFVGELIITAAEQLQTLSNHPEAEKMFPKGL
DVMNWLHNPDSTPEVDYLISAPVSFPLIGLVQMAHYEVTCKVLGIHPGQLRDRFGGTTGHSQGIVMAAATAAADS
WDSWRQIVDSTLAILFWIGTRSQQAFPTTSLTPTMLRESLDHGEGTPTPMLSIRDLSQQELQKHIDATNQYLPPH
RHISVSLVNSPRNLVVTGPPISLYGLNSQLRKVKAPTGLDQTRVPHTERKVRFSNRFLPITAPFHSKYLADATAM
IDEDLKNIRIESSSLGIPVFDTNNGKDLRSEVSGNVVPALVRLITRDPVNWEKATVFPKATHILDFGPGGVSGLG
PLTSRNKEGTGVRVIVAGVVDGTTLEVGYKPELFDRDEDNIRYAIDWVKEFGPRLVKTSSGRKYVDTKMSRLLGL
PPVMVAGMTPCTVPWDFVAATMNAGYHIELAGGGYFAPSMMTAALSKIEKAIPSGRGITVNLIYVNPMAMSWQIP
LIGKLRAEGVPIEGLTIGAGVPSIEVAQEYIETLGLKHIGFKPGSVEAVHAVINIAKANPSFPVLLQWTGGRGGG
HHSFEDFHQPILQMYGRIRRQENIILVAGSGFGSAKDTYPYLTGDWAKKYGYPPMPFDGCLFGSRMMVAKEAHTS
HDAKQAIVDAPGLEDAEWENTYKGPAGGVITVRSEMGEPIHKLATRGVRFWAEMDKKIFSLPKEKRVAELKKNRE
YIIKKLNDDFQKVWFGCNKEGKAVDLEDMTYAEVVRRMVELLYVKGQSRWIDPSFCTLTGDFIHRVEERFTASPN
QPSLLQSYADLKEPFAAVDRILSHYPESETQIINAQDVQHFLMLCMRPAQKPVTFIPALDENFEFFFKKDSLWQS
EDLDAVIGQDVGRTCILQGPTAAKYSTILNEPIKDILDGIHDAHITALMRDYYDNDERAIPAVEYFGGKLVDLEI
PLDVEGLTVNYDAHKNTYRLSSSATAAMPPLDSWLSLLAGPNRSWRYALLMSDVVVQGQKFQTNPMRRIFAPVRG
LFVEILYPNEPEKTTIIVREQPRHNQYVDVIEVKLSGKNEIIVKMIKDTTALGKPTTLALKFTYHAEAGYAPIHE
VMADRNDRIKEFYWRTWFGTDNVDLDADIMGKFDGGSTIITGEAIRDFVHAVGNTGEAFVDRPGKTVYAPMDFAI
VLGWKAITKPIFPRTIDGDLLRLVHLSNQFRMIPGADPLKKGDEIINNAQINAVINQDSGKMVEVCGTVSRNGEP
VMEVTSQFLYRGTYTDYENTFQRKIETPVQVHLATSKDVAVLRSKQWFAVDEIHGEMDLLGQTLTFRLQSLMRYK
NKTVFSSVETRGQVLLELPTKEVIQVASVDYEAGESHGNPVLDYLQRHGSPLDQPIYFENPIPLSGKGPLQLRAP
ASNETYARVSGDYNPIHVSRVFSSYANLPGTITHGMYSSASVRSLVETWAAENDIGRVRSFHASLVGMVLPNDDI
EVKLQHVGMVAGRKIIKVDVSNAETEEKVLSGEAEIEQPVTTYVFTGQGSQEQGMGMELYASSPVAKEVWDRADT
YLVDNYGFSITNIVKNNPKELTIHFGGPRGKAIRQNYMAMTFETVAADGTIKSERIFKEIDDSTTSYTYRSPTGL
LSATQFTQPALTLMEKASFEDMKSKGLVQGDSTFAGHSLGEYSALAALADVMPIESLVSVVFYRGLTMQVAVERD
ASGRSNYSMCAVNPSRISKTFNEEALQFVVNMIAEEKGWLLEIVNYNIANMQYVCAGDLRALDTLAGVTNYLKKK
EIDIEEMRSNIQEAKGVLRGIIRQCSEATLKKPVPLELERGFATIPLRGIDVPFHSTFLRSGVKPFRSFLLKKIH
KTTIDPSKLVGKYIPNVTAKPFALTKEYFEDVYKLTNSPKIGVVLANWDKYSQDDDGKDGSDSGASIPYEGPGAA
A*
Coding >Ophun1|2239
ATGTACGGCACAGCGACCGGCCCTCAGACGGGCATCTCTACTCCCAGATCGAGCGCCTCTCTCCGGCCATTGACC
ATCACTCACGGCTCTCTCGAAACCTCCTTTCTCGTCCCAAGCAACCTCCACTTTCACGCCTCTCAACTCAAGGAT
CGCCTGATTGCTACTCTGCCTGAAGCGACCGATGAGCTCGCCCATGATGATGAGCCATCGTCCGTCGCCGAGCTC
GTCGCCAGGTACCTAGGCCTCGTCGCTCGTGAGGTGGAGAACGGAGAGGATGATGCCCAAGGCTCTTACGAAGAG
GTCCTCAAGCTTGTTCTCAACGAGTTCGAGAGAGCCTTTCTGCGTGGCAACGAGGTCCACGCCGTTGCTGCTGCT
CTCCCGGGCATCGAAGCCAAGAAGCTTGAGGTGATCCGGAGCTACTACCTTGCCCGGGCTGTCGCCGAAAGAACC
ATCAAGCCCCATCAGTCTGCCTTGTTGCGGGCTGCAGACGACGGTTCCGCCGAGATCTACACCATCTTCGGCGGC
CAAGGCAATATTGAGCAATACTTTGAAGAGCTTCGCGAGGTCTTCCAAACGTATCCCAGCTTCGTCGGCGAACTC
ATCATCACCGCTGCCGAGCAGCTACAGACTCTTTCCAACCACCCCGAAGCCGAAAAGATGTTTCCCAAGGGCTTG
GACGTCATGAATTGGCTTCATAACCCAGACTCCACGCCAGAAGTCGACTATCTCATCTCGGCGCCCGTCAGCTTT
CCCCTCATCGGTCTGGTCCAAATGGCACACTACGAGGTCACCTGCAAGGTGCTCGGTATTCATCCAGGCCAGTTA
CGGGATCGATTCGGCGGCACGACAGGCCATTCCCAGGGCATTGTCATGGCCGCGGCAACTGCCGCGGCGGATTCG
TGGGACTCGTGGCGCCAGATCGTCGACTCGACCCTGGCCATCCTCTTTTGGATTGGAACGCGTAGCCAACAGGCG
TTCCCTACCACGTCTCTGACGCCCACCATGTTGCGCGAGTCGCTGGACCATGGCGAGGGCACTCCTACGCCTATG
CTGAGCATCCGAGACCTTTCCCAGCAGGAGCTTCAAAAGCACATCGATGCCACGAACCAGTACCTGCCTCCTCAC
CGTCACATCAGTGTGTCGCTGGTCAACAGCCCGCGCAACCTTGTTGTCACCGGGCCCCCGATCTCACTCTATGGT
CTCAACTCACAGTTGCGCAAGGTCAAGGCCCCAACGGGCCTCGATCAGACCCGCGTGCCACACACGGAGCGCAAG
GTTCGCTTTTCGAACCGATTCCTTCCCATCACGGCCCCCTTTCACAGCAAGTATCTTGCAGACGCAACCGCCATG
ATCGACGAGGATCTCAAGAATATCCGCATCGAATCCAGTTCCTTGGGGATCCCCGTCTTTGACACCAACAATGGC
AAGGATCTTCGGTCCGAAGTCAGCGGCAACGTTGTTCCGGCCCTGGTGCGCCTCATCACCCGCGATCCCGTCAAC
TGGGAGAAGGCCACCGTCTTTCCAAAGGCCACGCACATTCTGGACTTTGGCCCCGGCGGCGTGTCTGGCCTTGGC
CCCCTGACCAGCCGCAACAAAGAAGGGACCGGTGTTCGAGTGATTGTCGCCGGTGTCGTCGACGGCACCACTCTC
GAGGTCGGTTACAAGCCTGAGCTCTTCGATAGGGACGAGGACAATATCAGGTACGCCATCGACTGGGTCAAGGAG
TTTGGCCCTCGTCTGGTCAAAACGTCGAGTGGACGCAAGTACGTCGACACCAAGATGAGCCGCCTGCTGGGCTTG
CCTCCTGTCATGGTGGCCGGCATGACCCCTTGCACCGTGCCGTGGGACTTTGTCGCGGCAACCATGAATGCGGGC
TATCACATCGAACTCGCCGGTGGAGGCTACTTTGCCCCGAGCATGATGACGGCCGCCCTGTCCAAGATCGAGAAA
GCCATCCCGTCGGGCCGCGGCATCACCGTCAACTTGATATACGTCAACCCCATGGCTATGAGCTGGCAGATCCCG
CTCATTGGCAAATTACGAGCAGAGGGCGTGCCGATTGAGGGCTTGACCATCGGTGCCGGAGTTCCTTCCATTGAG
GTCGCGCAAGAGTACATCGAGACGTTGGGCCTAAAGCACATCGGCTTCAAGCCCGGCTCCGTCGAAGCTGTTCAT
GCCGTCATCAACATTGCCAAGGCTAACCCGAGCTTCCCGGTCCTCCTGCAGTGGACCGGCGGCCGGGGCGGCGGT
CACCACTCTTTCGAAGACTTCCACCAGCCCATACTCCAGATGTACGGTCGCATCCGACGTCAGGAGAACATCATT
CTCGTTGCTGGCAGTGGTTTCGGAAGTGCCAAAGACACGTACCCCTACCTTACGGGTGACTGGGCCAAGAAGTAT
GGCTACCCCCCCATGCCTTTCGATGGCTGCCTCTTTGGCAGCCGCATGATGGTGGCAAAGGAAGCACATACGAGC
CACGACGCAAAGCAAGCCATTGTGGACGCCCCCGGCTTGGAAGATGCTGAGTGGGAGAACACGTACAAGGGACCC
GCTGGCGGCGTCATCACCGTTCGGTCGGAGATGGGCGAGCCCATTCACAAGCTCGCAACCAGAGGCGTGCGTTTC
TGGGCCGAGATGGACAAGAAGATCTTCAGCTTGCCCAAGGAAAAGAGGGTGGCAGAGCTGAAGAAGAACCGGGAG
TACATCATCAAGAAGCTCAACGACGACTTTCAGAAGGTCTGGTTCGGCTGCAATAAGGAAGGCAAGGCCGTCGAC
CTCGAGGATATGACGTACGCCGAGGTTGTGCGCCGCATGGTCGAGCTGCTCTATGTGAAGGGTCAAAGTCGATGG
ATCGACCCGTCCTTTTGCACGCTCACTGGCGACTTCATTCATCGCGTCGAGGAACGCTTCACCGCGTCTCCCAAC
CAACCGTCGTTGCTGCAGAGCTATGCCGACCTCAAGGAGCCTTTCGCTGCTGTCGACAGGATTCTCTCTCACTAC
CCCGAGTCGGAGACGCAGATCATCAACGCACAGGATGTCCAGCACTTCCTTATGCTGTGCATGCGACCGGCTCAG
AAGCCCGTCACCTTCATCCCGGCTTTGGATGAGAACTTTGAGTTCTTCTTCAAGAAGGACTCTCTTTGGCAGTCG
GAAGATCTCGACGCCGTCATCGGCCAAGATGTCGGCCGTACGTGTATCCTCCAGGGCCCGACGGCGGCCAAATAC
TCGACCATTCTGAATGAGCCCATAAAGGACATTCTTGACGGCATCCACGATGCTCATATCACCGCGTTGATGAGA
GACTACTACGATAACGACGAGCGCGCTATCCCAGCCGTCGAGTACTTCGGCGGCAAGCTGGTGGACCTCGAGATT
CCGCTCGACGTCGAGGGGCTGACCGTCAACTACGACGCTCACAAGAACACATACCGCTTGTCATCTTCGGCCACC
GCCGCCATGCCCCCCCTCGACTCCTGGCTCTCTCTTTTGGCCGGCCCTAACCGTAGCTGGCGATATGCGTTGTTG
ATGTCGGACGTCGTCGTTCAGGGCCAGAAATTCCAGACCAACCCCATGCGACGCATCTTTGCGCCCGTTCGCGGT
CTGTTTGTGGAAATTCTCTACCCCAATGAGCCAGAGAAGACGACCATCATCGTTCGGGAGCAGCCCAGGCACAAC
CAGTACGTCGACGTCATCGAAGTGAAATTGAGTGGGAAGAACGAGATTATCGTGAAGATGATCAAAGATACGACG
GCTCTGGGCAAGCCAACAACCTTGGCACTCAAGTTCACGTATCACGCTGAGGCCGGTTACGCCCCCATCCACGAA
GTCATGGCGGATCGCAACGATCGCATCAAGGAGTTCTACTGGCGCACCTGGTTTGGCACCGACAATGTTGATCTC
GACGCTGACATCATGGGCAAGTTTGATGGAGGCAGCACCATTATTACCGGCGAGGCCATCAGGGACTTCGTGCAT
GCCGTCGGCAACACCGGTGAGGCGTTCGTTGACAGGCCGGGAAAGACCGTCTACGCTCCCATGGACTTTGCCATC
GTCTTGGGCTGGAAGGCCATCACCAAGCCCATCTTCCCGCGCACCATCGACGGCGATCTGCTCAGGCTCGTCCAT
CTTTCGAACCAGTTCCGCATGATTCCTGGAGCGGACCCCCTGAAGAAGGGCGACGAGATCATCAATAACGCCCAG
ATCAACGCCGTCATCAACCAAGACTCGGGCAAGATGGTCGAGGTCTGCGGCACCGTTTCTCGAAACGGCGAACCG
GTCATGGAGGTGACGTCGCAGTTCCTGTATCGCGGAACGTACACCGACTACGAAAACACGTTCCAGCGCAAGATC
GAGACTCCAGTGCAGGTCCATCTGGCTACGAGCAAGGACGTGGCCGTCCTCCGGTCGAAGCAGTGGTTTGCCGTG
GACGAGATTCACGGCGAAATGGACTTGCTCGGCCAGACACTGACGTTCCGGCTGCAGAGTCTTATGCGCTACAAG
AACAAGACCGTGTTCAGCAGTGTCGAGACTCGCGGCCAGGTTCTGCTGGAGTTGCCGACCAAGGAGGTCATTCAG
GTGGCGAGCGTCGACTACGAAGCGGGCGAGTCTCATGGAAACCCCGTCTTGGACTACCTGCAGAGACACGGGTCG
CCGCTGGATCAGCCCATCTACTTTGAGAACCCGATTCCCCTGAGCGGCAAAGGGCCACTGCAGCTGCGCGCGCCG
GCCTCCAACGAGACGTACGCTCGCGTCTCCGGGGACTACAACCCCATTCACGTCTCACGCGTCTTCTCGAGCTAC
GCGAATCTGCCAGGTACCATCACGCATGGCATGTACTCGAGTGCCTCCGTCCGGAGTCTCGTCGAGACATGGGCT
GCCGAGAACGACATTGGCCGGGTGCGAAGCTTCCACGCGTCCTTGGTCGGCATGGTTCTCCCCAATGACGACATT
GAGGTCAAGCTGCAGCACGTCGGAATGGTAGCTGGCCGCAAGATCATCAAGGTCGATGTCAGCAACGCGGAGACG
GAGGAGAAGGTGCTCTCCGGCGAGGCCGAAATTGAGCAACCCGTGACGACGTACGTGTTCACCGGGCAGGGATCA
CAGGAGCAGGGCATGGGCATGGAACTGTACGCGAGCAGCCCCGTGGCCAAGGAAGTCTGGGATCGCGCGGACACG
TATCTGGTCGACAACTATGGCTTCTCAATTACCAACATCGTCAAGAACAACCCCAAGGAACTCACAATCCACTTT
GGAGGGCCGAGAGGTAAGGCTATCAGGCAGAACTACATGGCCATGACATTCGAGACGGTGGCCGCAGATGGGACC
ATCAAGTCGGAGCGCATCTTCAAGGAAATCGACGACAGCACGACCTCGTACACGTACCGGTCGCCCACCGGACTG
CTGTCGGCGACACAGTTTACGCAGCCTGCGCTGACGCTGATGGAAAAGGCCAGCTTCGAGGACATGAAGTCCAAG
GGCCTCGTTCAAGGAGACAGCACGTTTGCCGGCCACTCGCTGGGAGAGTACTCCGCTCTGGCGGCATTGGCGGAC
GTGATGCCCATCGAGTCGCTGGTCTCCGTCGTTTTCTACAGGGGCTTGACGATGCAGGTGGCCGTGGAGCGCGAC
GCCAGCGGGCGATCCAATTACTCCATGTGCGCCGTGAACCCCAGCCGCATCTCCAAGACGTTCAACGAGGAGGCG
CTGCAGTTCGTCGTCAACATGATCGCGGAAGAGAAGGGCTGGCTTCTGGAGATTGTCAACTACAACATCGCCAAC
ATGCAGTACGTCTGCGCAGGCGACCTCAGGGCGCTCGACACGCTTGCCGGAGTCACCAACTACCTCAAGAAGAAG
GAGATTGACATTGAGGAGATGCGGAGCAACATCCAGGAGGCCAAGGGAGTGCTGCGAGGAATCATCCGTCAATGC
TCCGAGGCGACGCTCAAGAAGCCGGTGCCTCTGGAGCTGGAACGAGGGTTTGCCACCATTCCGCTGCGAGGCATC
GACGTGCCTTTCCACTCGACCTTTTTGCGGTCCGGCGTCAAGCCGTTCCGGTCTTTCCTGCTCAAGAAGATCCAC
AAGACGACAATCGACCCGTCGAAGCTGGTTGGGAAATACATTCCCAATGTGACGGCCAAGCCATTTGCGCTCACC
AAGGAGTACTTTGAGGACGTGTATAAGCTGACCAACTCGCCCAAGATCGGGGTCGTGCTGGCCAACTGGGACAAG
TACTCGCAGGATGACGATGGCAAGGACGGCAGTGACAGCGGCGCGAGCATCCCCTACGAGGGTCCAGGCGCGGCC
GCTTGA
Transcript >Ophun1|2239
ATGTACGGCACAGCGACCGGCCCTCAGACGGGCATCTCTACTCCCAGATCGAGCGCCTCTCTCCGGCCATTGACC
ATCACTCACGGCTCTCTCGAAACCTCCTTTCTCGTCCCAAGCAACCTCCACTTTCACGCCTCTCAACTCAAGGAT
CGCCTGATTGCTACTCTGCCTGAAGCGACCGATGAGCTCGCCCATGATGATGAGCCATCGTCCGTCGCCGAGCTC
GTCGCCAGGTACCTAGGCCTCGTCGCTCGTGAGGTGGAGAACGGAGAGGATGATGCCCAAGGCTCTTACGAAGAG
GTCCTCAAGCTTGTTCTCAACGAGTTCGAGAGAGCCTTTCTGCGTGGCAACGAGGTCCACGCCGTTGCTGCTGCT
CTCCCGGGCATCGAAGCCAAGAAGCTTGAGGTGATCCGGAGCTACTACCTTGCCCGGGCTGTCGCCGAAAGAACC
ATCAAGCCCCATCAGTCTGCCTTGTTGCGGGCTGCAGACGACGGTTCCGCCGAGATCTACACCATCTTCGGCGGC
CAAGGCAATATTGAGCAATACTTTGAAGAGCTTCGCGAGGTCTTCCAAACGTATCCCAGCTTCGTCGGCGAACTC
ATCATCACCGCTGCCGAGCAGCTACAGACTCTTTCCAACCACCCCGAAGCCGAAAAGATGTTTCCCAAGGGCTTG
GACGTCATGAATTGGCTTCATAACCCAGACTCCACGCCAGAAGTCGACTATCTCATCTCGGCGCCCGTCAGCTTT
CCCCTCATCGGTCTGGTCCAAATGGCACACTACGAGGTCACCTGCAAGGTGCTCGGTATTCATCCAGGCCAGTTA
CGGGATCGATTCGGCGGCACGACAGGCCATTCCCAGGGCATTGTCATGGCCGCGGCAACTGCCGCGGCGGATTCG
TGGGACTCGTGGCGCCAGATCGTCGACTCGACCCTGGCCATCCTCTTTTGGATTGGAACGCGTAGCCAACAGGCG
TTCCCTACCACGTCTCTGACGCCCACCATGTTGCGCGAGTCGCTGGACCATGGCGAGGGCACTCCTACGCCTATG
CTGAGCATCCGAGACCTTTCCCAGCAGGAGCTTCAAAAGCACATCGATGCCACGAACCAGTACCTGCCTCCTCAC
CGTCACATCAGTGTGTCGCTGGTCAACAGCCCGCGCAACCTTGTTGTCACCGGGCCCCCGATCTCACTCTATGGT
CTCAACTCACAGTTGCGCAAGGTCAAGGCCCCAACGGGCCTCGATCAGACCCGCGTGCCACACACGGAGCGCAAG
GTTCGCTTTTCGAACCGATTCCTTCCCATCACGGCCCCCTTTCACAGCAAGTATCTTGCAGACGCAACCGCCATG
ATCGACGAGGATCTCAAGAATATCCGCATCGAATCCAGTTCCTTGGGGATCCCCGTCTTTGACACCAACAATGGC
AAGGATCTTCGGTCCGAAGTCAGCGGCAACGTTGTTCCGGCCCTGGTGCGCCTCATCACCCGCGATCCCGTCAAC
TGGGAGAAGGCCACCGTCTTTCCAAAGGCCACGCACATTCTGGACTTTGGCCCCGGCGGCGTGTCTGGCCTTGGC
CCCCTGACCAGCCGCAACAAAGAAGGGACCGGTGTTCGAGTGATTGTCGCCGGTGTCGTCGACGGCACCACTCTC
GAGGTCGGTTACAAGCCTGAGCTCTTCGATAGGGACGAGGACAATATCAGGTACGCCATCGACTGGGTCAAGGAG
TTTGGCCCTCGTCTGGTCAAAACGTCGAGTGGACGCAAGTACGTCGACACCAAGATGAGCCGCCTGCTGGGCTTG
CCTCCTGTCATGGTGGCCGGCATGACCCCTTGCACCGTGCCGTGGGACTTTGTCGCGGCAACCATGAATGCGGGC
TATCACATCGAACTCGCCGGTGGAGGCTACTTTGCCCCGAGCATGATGACGGCCGCCCTGTCCAAGATCGAGAAA
GCCATCCCGTCGGGCCGCGGCATCACCGTCAACTTGATATACGTCAACCCCATGGCTATGAGCTGGCAGATCCCG
CTCATTGGCAAATTACGAGCAGAGGGCGTGCCGATTGAGGGCTTGACCATCGGTGCCGGAGTTCCTTCCATTGAG
GTCGCGCAAGAGTACATCGAGACGTTGGGCCTAAAGCACATCGGCTTCAAGCCCGGCTCCGTCGAAGCTGTTCAT
GCCGTCATCAACATTGCCAAGGCTAACCCGAGCTTCCCGGTCCTCCTGCAGTGGACCGGCGGCCGGGGCGGCGGT
CACCACTCTTTCGAAGACTTCCACCAGCCCATACTCCAGATGTACGGTCGCATCCGACGTCAGGAGAACATCATT
CTCGTTGCTGGCAGTGGTTTCGGAAGTGCCAAAGACACGTACCCCTACCTTACGGGTGACTGGGCCAAGAAGTAT
GGCTACCCCCCCATGCCTTTCGATGGCTGCCTCTTTGGCAGCCGCATGATGGTGGCAAAGGAAGCACATACGAGC
CACGACGCAAAGCAAGCCATTGTGGACGCCCCCGGCTTGGAAGATGCTGAGTGGGAGAACACGTACAAGGGACCC
GCTGGCGGCGTCATCACCGTTCGGTCGGAGATGGGCGAGCCCATTCACAAGCTCGCAACCAGAGGCGTGCGTTTC
TGGGCCGAGATGGACAAGAAGATCTTCAGCTTGCCCAAGGAAAAGAGGGTGGCAGAGCTGAAGAAGAACCGGGAG
TACATCATCAAGAAGCTCAACGACGACTTTCAGAAGGTCTGGTTCGGCTGCAATAAGGAAGGCAAGGCCGTCGAC
CTCGAGGATATGACGTACGCCGAGGTTGTGCGCCGCATGGTCGAGCTGCTCTATGTGAAGGGTCAAAGTCGATGG
ATCGACCCGTCCTTTTGCACGCTCACTGGCGACTTCATTCATCGCGTCGAGGAACGCTTCACCGCGTCTCCCAAC
CAACCGTCGTTGCTGCAGAGCTATGCCGACCTCAAGGAGCCTTTCGCTGCTGTCGACAGGATTCTCTCTCACTAC
CCCGAGTCGGAGACGCAGATCATCAACGCACAGGATGTCCAGCACTTCCTTATGCTGTGCATGCGACCGGCTCAG
AAGCCCGTCACCTTCATCCCGGCTTTGGATGAGAACTTTGAGTTCTTCTTCAAGAAGGACTCTCTTTGGCAGTCG
GAAGATCTCGACGCCGTCATCGGCCAAGATGTCGGCCGTACGTGTATCCTCCAGGGCCCGACGGCGGCCAAATAC
TCGACCATTCTGAATGAGCCCATAAAGGACATTCTTGACGGCATCCACGATGCTCATATCACCGCGTTGATGAGA
GACTACTACGATAACGACGAGCGCGCTATCCCAGCCGTCGAGTACTTCGGCGGCAAGCTGGTGGACCTCGAGATT
CCGCTCGACGTCGAGGGGCTGACCGTCAACTACGACGCTCACAAGAACACATACCGCTTGTCATCTTCGGCCACC
GCCGCCATGCCCCCCCTCGACTCCTGGCTCTCTCTTTTGGCCGGCCCTAACCGTAGCTGGCGATATGCGTTGTTG
ATGTCGGACGTCGTCGTTCAGGGCCAGAAATTCCAGACCAACCCCATGCGACGCATCTTTGCGCCCGTTCGCGGT
CTGTTTGTGGAAATTCTCTACCCCAATGAGCCAGAGAAGACGACCATCATCGTTCGGGAGCAGCCCAGGCACAAC
CAGTACGTCGACGTCATCGAAGTGAAATTGAGTGGGAAGAACGAGATTATCGTGAAGATGATCAAAGATACGACG
GCTCTGGGCAAGCCAACAACCTTGGCACTCAAGTTCACGTATCACGCTGAGGCCGGTTACGCCCCCATCCACGAA
GTCATGGCGGATCGCAACGATCGCATCAAGGAGTTCTACTGGCGCACCTGGTTTGGCACCGACAATGTTGATCTC
GACGCTGACATCATGGGCAAGTTTGATGGAGGCAGCACCATTATTACCGGCGAGGCCATCAGGGACTTCGTGCAT
GCCGTCGGCAACACCGGTGAGGCGTTCGTTGACAGGCCGGGAAAGACCGTCTACGCTCCCATGGACTTTGCCATC
GTCTTGGGCTGGAAGGCCATCACCAAGCCCATCTTCCCGCGCACCATCGACGGCGATCTGCTCAGGCTCGTCCAT
CTTTCGAACCAGTTCCGCATGATTCCTGGAGCGGACCCCCTGAAGAAGGGCGACGAGATCATCAATAACGCCCAG
ATCAACGCCGTCATCAACCAAGACTCGGGCAAGATGGTCGAGGTCTGCGGCACCGTTTCTCGAAACGGCGAACCG
GTCATGGAGGTGACGTCGCAGTTCCTGTATCGCGGAACGTACACCGACTACGAAAACACGTTCCAGCGCAAGATC
GAGACTCCAGTGCAGGTCCATCTGGCTACGAGCAAGGACGTGGCCGTCCTCCGGTCGAAGCAGTGGTTTGCCGTG
GACGAGATTCACGGCGAAATGGACTTGCTCGGCCAGACACTGACGTTCCGGCTGCAGAGTCTTATGCGCTACAAG
AACAAGACCGTGTTCAGCAGTGTCGAGACTCGCGGCCAGGTTCTGCTGGAGTTGCCGACCAAGGAGGTCATTCAG
GTGGCGAGCGTCGACTACGAAGCGGGCGAGTCTCATGGAAACCCCGTCTTGGACTACCTGCAGAGACACGGGTCG
CCGCTGGATCAGCCCATCTACTTTGAGAACCCGATTCCCCTGAGCGGCAAAGGGCCACTGCAGCTGCGCGCGCCG
GCCTCCAACGAGACGTACGCTCGCGTCTCCGGGGACTACAACCCCATTCACGTCTCACGCGTCTTCTCGAGCTAC
GCGAATCTGCCAGGTACCATCACGCATGGCATGTACTCGAGTGCCTCCGTCCGGAGTCTCGTCGAGACATGGGCT
GCCGAGAACGACATTGGCCGGGTGCGAAGCTTCCACGCGTCCTTGGTCGGCATGGTTCTCCCCAATGACGACATT
GAGGTCAAGCTGCAGCACGTCGGAATGGTAGCTGGCCGCAAGATCATCAAGGTCGATGTCAGCAACGCGGAGACG
GAGGAGAAGGTGCTCTCCGGCGAGGCCGAAATTGAGCAACCCGTGACGACGTACGTGTTCACCGGGCAGGGATCA
CAGGAGCAGGGCATGGGCATGGAACTGTACGCGAGCAGCCCCGTGGCCAAGGAAGTCTGGGATCGCGCGGACACG
TATCTGGTCGACAACTATGGCTTCTCAATTACCAACATCGTCAAGAACAACCCCAAGGAACTCACAATCCACTTT
GGAGGGCCGAGAGGTAAGGCTATCAGGCAGAACTACATGGCCATGACATTCGAGACGGTGGCCGCAGATGGGACC
ATCAAGTCGGAGCGCATCTTCAAGGAAATCGACGACAGCACGACCTCGTACACGTACCGGTCGCCCACCGGACTG
CTGTCGGCGACACAGTTTACGCAGCCTGCGCTGACGCTGATGGAAAAGGCCAGCTTCGAGGACATGAAGTCCAAG
GGCCTCGTTCAAGGAGACAGCACGTTTGCCGGCCACTCGCTGGGAGAGTACTCCGCTCTGGCGGCATTGGCGGAC
GTGATGCCCATCGAGTCGCTGGTCTCCGTCGTTTTCTACAGGGGCTTGACGATGCAGGTGGCCGTGGAGCGCGAC
GCCAGCGGGCGATCCAATTACTCCATGTGCGCCGTGAACCCCAGCCGCATCTCCAAGACGTTCAACGAGGAGGCG
CTGCAGTTCGTCGTCAACATGATCGCGGAAGAGAAGGGCTGGCTTCTGGAGATTGTCAACTACAACATCGCCAAC
ATGCAGTACGTCTGCGCAGGCGACCTCAGGGCGCTCGACACGCTTGCCGGAGTCACCAACTACCTCAAGAAGAAG
GAGATTGACATTGAGGAGATGCGGAGCAACATCCAGGAGGCCAAGGGAGTGCTGCGAGGAATCATCCGTCAATGC
TCCGAGGCGACGCTCAAGAAGCCGGTGCCTCTGGAGCTGGAACGAGGGTTTGCCACCATTCCGCTGCGAGGCATC
GACGTGCCTTTCCACTCGACCTTTTTGCGGTCCGGCGTCAAGCCGTTCCGGTCTTTCCTGCTCAAGAAGATCCAC
AAGACGACAATCGACCCGTCGAAGCTGGTTGGGAAATACATTCCCAATGTGACGGCCAAGCCATTTGCGCTCACC
AAGGAGTACTTTGAGGACGTGTATAAGCTGACCAACTCGCCCAAGATCGGGGTCGTGCTGGCCAACTGGGACAAG
TACTCGCAGGATGACGATGGCAAGGACGGCAGTGACAGCGGCGCGAGCATCCCCTACGAGGGTCCAGGCGCGGCC
GCTTGA
Gene >Ophun1|2239
ATGTACGGCACAGCGACCGGCCCTCAGACGGGCATCTCTACTCCCAGATCGAGCGCCTCTCTCCGGCCATTGACC
ATCACTCACGGCTCTCTCGAAACCTCCTTTCTCGTCCCAAGCAACCTCCACTTTCACGCCTCTCAACTCAAGGAT
CGCCTGATTGCTACTCTGCCTGAAGCGACCGATGAGCTCGCCCATGATGATGAGCCATCGTCCGTCGCCGAGCTC
GTCGCCAGGTACCTAGGCCTCGTCGCTCGTGAGGTGGAGAACGGAGAGGATGATGCCCAAGGCTCTTACGAAGAG
GTCCTCAAGCTTGTTCTCAACGAGTTCGAGAGAGCCTTTCTGCGTGGCAACGAGGTCCACGCCGTTGCTGCTGCT
CTCCCGGGCATCGAAGCCAAGAAGCTTGAGGTGATCCGGAGCTACTACCTTGCCCGGGCTGTCGCCGAAAGAACC
ATCAAGCCCCATCAGTCTGCCTTGTTGCGGGCTGCAGACGACGGTTCCGCCGAGATCTACACCATCTTCGGCGGC
CAAGGCAATATTGAGCAATACTTTGAAGAGCTTCGCGAGGTCTTCCAAACGTATCCCAGCTTCGTCGGCGAACTC
ATCATCACCGCTGCCGAGCAGCTACAGACTCTTTCCAACCACCCCGAAGCCGAAAAGATGTTTCCCAAGGGCTTG
GACGTCATGAATTGGCTTCATAACCCAGACTCCACGCCAGAAGTCGACTATCTCATCTCGGCGCCCGTCAGCTTT
CCCCTCATCGGTCTGGTCCAAATGGCACACTACGAGGTCACCTGCAAGGTGCTCGGTATTCATCCAGGCCAGTTA
CGGGATCGATTCGGCGGCACGACAGGCCATTCCCAGGGCATTGTCATGGCCGCGGCAACTGCCGCGGCGGATTCG
TGGGACTCGTGGCGCCAGATCGTCGACTCGACCCTGGCCATCCTCTTTTGGATTGGAACGCGTAGCCAACAGGCG
TTCCCTACCACGTCTCTGACGCCCACCATGTTGCGCGAGTCGCTGGACCATGGCGAGGGCACTCCTACGCCTATG
CTGAGCATCCGAGACCTTTCCCAGCAGGAGCTTCAAAAGCACATCGATGCCACGAACCAGTACCTGCCTCCTCAC
CGTCACATCAGTGTGTCGCTGGTCAACAGCCCGCGCAACCTTGTTGTCACCGGGCCCCCGATCTCACTCTATGGT
CTCAACTCACAGTTGCGCAAGGTCAAGGCCCCAACGGGCCTCGATCAGACCCGCGTGCCACACACGGAGCGCAAG
GTTCGCTTTTCGAACCGATTCCTTCCCATCACGGCCCCCTTTCACAGCAAGTATCTTGCAGACGCAACCGCCATG
ATCGACGAGGATCTCAAGAATATCCGCATCGAATCCAGTTCCTTGGGGATCCCCGTCTTTGACACCAACAATGGC
AAGGATCTTCGGTCCGAAGTCAGCGGCAACGTTGTTCCGGCCCTGGTGCGCCTCATCACCCGCGATCCCGTCAAC
TGGGAGAAGGCCACCGTCTTTCCAAAGGCCACGCACATTCTGGACTTTGGCCCCGGCGGCGTGTCTGGCCTTGGC
CCCCTGACCAGCCGCAACAAAGAAGGGACCGGTGTTCGAGTGATTGTCGCCGGTGTCGTCGACGGCACCACTCTC
GAGGTCGGTTACAAGCCTGAGCTCTTCGATAGGGACGAGGACAATATCAGGTACGCCATCGACTGGGTCAAGGAG
TTTGGCCCTCGTCTGGTCAAAACGTCGAGTGGACGCAAGTACGTCGACACCAAGATGAGCCGCCTGCTGGGCTTG
CCTCCTGTCATGGTGGCCGGCATGACCCCTTGCACCGTGCCGTGGGACTTTGTCGCGGCAACCATGAATGCGGGC
TATCACATCGAACTCGCCGGTGGAGGCTACTTTGCCCCGAGCATGATGACGGCCGCCCTGTCCAAGATCGAGAAA
GCCATCCCGTCGGGCCGCGGCATCACCGTCAACTTGATATACGTCAACCCCATGGCTATGAGCTGGCAGATCCCG
CTCATTGGCAAATTACGAGCAGAGGGCGTGCCGATTGAGGGCTTGACCATCGGTGCCGGAGTTCCTTCCATTGAG
GTCGCGCAAGAGTACATCGAGACGTTGGGCCTAAAGCACATCGGCTTCAAGCCCGGCTCCGTCGAAGCTGTTCAT
GCCGTCATCAACATTGCCAAGGCTAACCCGAGCTTCCCGGTCCTCCTGCAGTGGACCGGCGGCCGGGGCGGCGGT
CACCACTCTTTCGAAGACTTCCACCAGCCCATACTCCAGATGTACGGTCGCATCCGACGTCAGGAGAACATCATT
CTCGTTGCTGGCAGTGGTTTCGGAAGTGCCAAAGACACGTACCCCTACCTTACGGGTGACTGGGCCAAGAAGTAT
GGCTACCCCCCCATGCCTTTCGATGGCTGCCTCTTTGGCAGCCGCATGATGGTGGCAAAGGAAGCACATACGAGC
CACGACGCAAAGCAAGCCATTGTGGACGCCCCCGGCTTGGAAGATGCTGAGTGGGAGAACACGTACAAGGGACCC
GCTGGCGGCGTCATCACCGTTCGGTCGGAGATGGGCGAGCCCATTCACAAGCTCGCAACCAGAGGCGTGCGTTTC
TGGGCCGAGATGGACAAGAAGATCTTCAGCTTGCCCAAGGAAAAGAGGGTGGCAGAGCTGAAGAAGAACCGGGAG
TACATCATCAAGAAGCTCAACGACGACTTTCAGAAGGTCTGGTTCGGCTGCAATAAGGAAGGCAAGGCCGTCGAC
CTCGAGGATATGACGTACGCCGAGGTTGTGCGCCGCATGGTCGAGCTGCTCTATGTGAAGGGTCAAAGTCGATGG
ATCGACCCGTCCTTTTGCACGCTCACTGGCGACTTCATTCATCGCGTCGAGGAACGCTTCACCGCGTCTCCCAAC
CAACCGTCGTTGCTGCAGAGCTATGCCGACCTCAAGGAGCCTTTCGCTGCTGTCGACAGGATTCTCTCTCACTAC
CCCGAGTCGGAGACGCAGATCATCAACGCACAGGATGTCCAGCACTTCCTTATGCTGTGCATGCGACCGGCTCAG
AAGCCCGTCACCTTCATCCCGGCTTTGGATGAGAACTTTGAGTTCTTCTTCAAGAAGGACTCTCTTTGGCAGTCG
GAAGATCTCGACGCCGTCATCGGCCAAGATGTCGGCCGTACGTGTATCCTCCAGGGCCCGACGGCGGCCAAATAC
TCGACCATTCTGAATGAGCCCATAAAGGACATTCTTGACGGCATCCACGATGCTCATATCACCGCGTTGATGAGA
GACTACTACGATAACGACGAGCGCGCTATCCCAGCCGTCGAGTACTTCGGCGGCAAGCTGGTGGACCTCGAGATT
CCGCTCGACGTCGAGGGGCTGACCGTCAACTACGACGCTCACAAGAACACATACCGCTTGTCATCTTCGGCCACC
GCCGCCATGCCCCCCCTCGACTCCTGGCTCTCTCTTTTGGCCGGCCCTAACCGTAGCTGGCGATATGCGTTGTTG
ATGTCGGACGTCGTCGTTCAGGGCCAGAAATTCCAGACCAACCCCATGCGACGCATCTTTGCGCCCGTTCGCGGT
CTGTTTGTGGAAATTCTCTACCCCAATGAGCCAGAGAAGACGACCATCATCGTTCGGGAGCAGCCCAGGCACAAC
CAGTACGTCGACGTCATCGAAGTGAAATTGAGTGGGAAGAACGAGATTATCGTGAAGATGATCAAAGATACGACG
GCTCTGGGCAAGCCAACAACCTTGGCACTCAAGTTCACGTATCACGCTGAGGCCGGTTACGCCCCCATCCACGAA
GTCATGGCGGATCGCAACGATCGCATCAAGGAGTTCTACTGGCGCACCTGGTTTGGCACCGACAATGTTGATCTC
GACGCTGACATCATGGGCAAGTTTGATGGAGGCAGCACCATTATTACCGGCGAGGCCATCAGGGACTTCGTGCAT
GCCGTCGGCAACACCGGTGAGGCGTTCGTTGACAGGCCGGGAAAGACCGTCTACGCTCCCATGGACTTTGCCATC
GTCTTGGGCTGGAAGGCCATCACCAAGCCCATCTTCCCGCGCACCATCGACGGCGATCTGCTCAGGCTCGTCCAT
CTTTCGAACCAGTTCCGCATGATTCCTGGAGCGGACCCCCTGAAGAAGGGCGACGAGATCATCAATAACGCCCAG
ATCAACGCCGTCATCAACCAAGACTCGGGCAAGATGGTCGAGGTCTGCGGCACCGTTTCTCGAAACGGCGAACCG
GTCATGGAGGTGACGTCGCAGTTCCTGTATCGCGGAACGTACACCGACTACGAAAACACGTTCCAGCGCAAGATC
GAGACTCCAGTGCAGGTCCATCTGGCTACGAGCAAGGACGTGGCCGTCCTCCGGTCGAAGCAGTGGTTTGCCGTG
GACGAGATTCACGGCGAAATGGACTTGCTCGGCCAGACACTGACGTTCCGGCTGCAGAGTCTTATGCGCTACAAG
AACAAGACCGTGTTCAGCAGTGTCGAGACTCGCGGCCAGGTTCTGCTGGAGTTGCCGACCAAGGAGGTCATTCAG
GTGGCGAGCGTCGACTACGAAGCGGGCGAGTCTCATGGAAACCCCGTCTTGGACTACCTGCAGAGACACGGGTCG
CCGCTGGATCAGCCCATCTACTTTGAGAACCCGATTCCCCTGAGCGGCAAAGGGCCACTGCAGCTGCGCGCGCCG
GCCTCCAACGAGACGTACGCTCGCGTCTCCGGGGACTACAACCCCATTCACGTCTCACGCGTCTTCTCGAGCTAC
GCGAATCTGCCAGGTACCATCACGCATGGCATGTACTCGAGTGCCTCCGTCCGGAGTCTCGTCGAGACATGGGCT
GCCGAGAACGACATTGGCCGGGTGCGAAGCTTCCACGCGTCCTTGGTCGGCATGGTTCTCCCCAATGACGACATT
GAGGTCAAGCTGCAGCACGTCGGAATGGTAGCTGGCCGCAAGATCATCAAGGTCGATGTCAGCAACGCGGAGACG
GAGGAGAAGGTGCTCTCCGGCGAGGCCGAAATTGAGCAACCCGTGACGACGTACGTGTTCACCGGGCAGGGATCA
CAGGAGCAGGGCATGGGCATGGAACTGTACGCGAGCAGCCCCGTGGCCAAGGAAGTCTGGGATCGCGCGGACACG
TATCTGGTCGACAACTATGGTGAGTGTCCTCGGATGTGGCCTCGTGGCCGTTCGCTGGCTTGACGGGGAGGGACC
GAGACTGACTTGGCTATTTCCAGGCTTCTCAATTACCAACATCGTCAAGAACAACCCCAAGGAACTCACAATCCA
CTTTGGAGGGCCGAGAGGTAAGGCTATCAGGCAGAACTACATGGCCATGACATTCGAGACGGTGGCCGCAGATGG
GACCATCAAGTCGGAGCGCATCTTCAAGGAAATCGACGACAGCACGACCTCGTACACGTACCGGTCGCCCACCGG
ACTGCTGTCGGCGACACAGTTTACGCAGCCTGCGCTGACGCTGATGGAAAAGGCCAGCTTCGAGGACATGAAGTC
CAAGGGCCTCGTTCAAGGAGACAGCACGTTTGCCGGCCACTCGCTGGGAGAGTACTCCGCTCTGGCGGCATTGGC
GGACGTGATGCCCATCGAGTCGCTGGTCTCCGTCGTTTTCTACAGGGGCTTGACGATGCAGGTGGCCGTGGAGCG
CGACGCCAGCGGGCGATCCAATTACTCCATGTGCGCCGTGAACCCCAGCCGCATCTCCAAGACGTTCAACGAGGA
GGCGCTGCAGTTCGTCGTCAACATGATCGCGGAAGAGAAGGGCTGGCTTCTGGAGATTGTCAACTACAACATCGC
CAACATGCAGTACGTCTGCGCAGGCGACCTCAGGGCGCTCGACACGCTTGCCGGAGTCACCAACTACCTCAAGAA
GAAGGAGATTGACATTGAGGAGATGCGGAGCAACATCCAGGAGGCCAAGGGAGTGCTGCGAGGAATCATCCGTCA
ATGCTCCGAGGCGACGCTCAAGAAGCCGGTGCCTCTGGAGCTGGAACGAGGGTTTGCCACCATTCCGCTGCGAGG
CATCGACGTGCCTTTCCACTCGACCTTTTTGCGGTCCGGCGTCAAGCCGTTCCGGTCTTTCCTGCTCAAGAAGAT
CCACAAGACGACAATCGACCCGTCGAAGCTGGTTGGGAAATACATTCCCAATGTGACGGCCAAGCCATTTGCGCT
CACCAAGGAGTACTTTGAGGACGTGTATAAGCTGACCAACTCGCCCAAGATCGGGGTCGTGCTGGCCAACTGGGA
CAAGTACTCGCAGGATGACGATGGCAAGGACGGCAGTGACAGCGGCGCGAGCATCCCCTACGAGGGTCCAGGCGC
GGCCGCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail