Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2239
Gene name
LocationContig_207:10505..16890
Strand-
Gene length (bp)6385
Transcript length (bp)6306
Coding sequence length (bp)6306
Protein length (aa) 2102

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08354 DUF1729 Domain of unknown function (DUF1729) 2.3E-159 738 1087
PF00698 Acyl_transf_1 Acyl transferase domain 2.1E-85 1692 2063
PF17951 FAS_meander Fatty acid synthase meander beta sheet domain 6.2E-51 1151 1294
PF17828 FAS_N N-terminal domain in fatty acid synthase subunit beta 5.8E-36 20 146
PF01575 MaoC_dehydratas MaoC like domain 1.5E-35 1550 1677
PF16073 SAT Starter unit:ACP transacylase in aflatoxin biosynthesis 2.0E-34 172 424
PF13452 MaoC_dehydrat_N N-terminal half of MaoC dehydratase 5.4E-25 1306 1428

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P34229|FAS1_YARLI Fatty acid synthase subunit beta OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=FAS1 PE=3 SV=2 8 2076 0.0E+00
sp|P34731|FAS1_CANAX Fatty acid synthase subunit beta OS=Candida albicans GN=FAS1 PE=3 SV=1 22 2076 0.0E+00
sp|P07149|FAS1_YEAST Fatty acid synthase subunit beta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FAS1 PE=1 SV=2 20 2078 0.0E+00
sp|Q92215|TOXC_COCCA Putative fatty acid synthase subunit TOXC OS=Cochliobolus carbonum GN=TOXC PE=3 SV=1 20 2080 0.0E+00
sp|Q9UUG0|FAS1_SCHPO Fatty acid synthase subunit beta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fas1 PE=1 SV=1 20 2076 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P34229|FAS1_YARLI Fatty acid synthase subunit beta OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=FAS1 PE=3 SV=2 8 2076 0.0E+00
sp|P34731|FAS1_CANAX Fatty acid synthase subunit beta OS=Candida albicans GN=FAS1 PE=3 SV=1 22 2076 0.0E+00
sp|P07149|FAS1_YEAST Fatty acid synthase subunit beta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FAS1 PE=1 SV=2 20 2078 0.0E+00
sp|Q92215|TOXC_COCCA Putative fatty acid synthase subunit TOXC OS=Cochliobolus carbonum GN=TOXC PE=3 SV=1 20 2080 0.0E+00
sp|Q9UUG0|FAS1_SCHPO Fatty acid synthase subunit beta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fas1 PE=1 SV=1 20 2076 0.0E+00
sp|Q00706|STCK_EMENI Putative sterigmatocystin biosynthesis fatty acid synthase subunit beta OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcK PE=3 SV=2 156 2063 0.0E+00
sp|Q54TW0|PKS18_DICDI Probable polyketide synthase 18 OS=Dictyostelium discoideum GN=pks18 PE=2 SV=1 1687 1890 1.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0004318 enoyl-[acyl-carrier-protein] reductase (NADH) activity Yes
GO:0004317 3-hydroxypalmitoyl-[acyl-carrier-protein] dehydratase activity Yes
GO:0016627 oxidoreductase activity, acting on the CH-CH group of donors No
GO:0019171 3-hydroxyacyl-[acyl-carrier-protein] dehydratase activity No
GO:0016747 acyltransferase activity, transferring groups other than amino-acyl groups No
GO:0016835 carbon-oxygen lyase activity No
GO:0003674 molecular_function No
GO:0016740 transferase activity No
GO:0003824 catalytic activity No
GO:0016628 oxidoreductase activity, acting on the CH-CH group of donors, NAD or NADP as acceptor No
GO:0016836 hydro-lyase activity No
GO:0016491 oxidoreductase activity No
GO:0016829 lyase activity No
GO:0016746 acyltransferase activity No
GO:0004312 fatty acid synthase activity No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

Gene cluster ID Type of secondary metabolism gene
Cluster 13 (None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5329
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7163
Ophiocordyceps australis map64 (Brazil) OphauB2|4244
Ophiocordyceps camponoti-floridani Ophcf2|04211
Ophiocordyceps camponoti-rufipedis Ophun1|2239 (this protein)
Ophiocordyceps kimflemingae Ophio5|8013
Ophiocordyceps subramaniannii Hirsu2|5043

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2239
MYGTATGPQTGISTPRSSASLRPLTITHGSLETSFLVPSNLHFHASQLKDRLIATLPEATDELAHDDEPSSVAEL
VARYLGLVAREVENGEDDAQGSYEEVLKLVLNEFERAFLRGNEVHAVAAALPGIEAKKLEVIRSYYLARAVAERT
IKPHQSALLRAADDGSAEIYTIFGGQGNIEQYFEELREVFQTYPSFVGELIITAAEQLQTLSNHPEAEKMFPKGL
DVMNWLHNPDSTPEVDYLISAPVSFPLIGLVQMAHYEVTCKVLGIHPGQLRDRFGGTTGHSQGIVMAAATAAADS
WDSWRQIVDSTLAILFWIGTRSQQAFPTTSLTPTMLRESLDHGEGTPTPMLSIRDLSQQELQKHIDATNQYLPPH
RHISVSLVNSPRNLVVTGPPISLYGLNSQLRKVKAPTGLDQTRVPHTERKVRFSNRFLPITAPFHSKYLADATAM
IDEDLKNIRIESSSLGIPVFDTNNGKDLRSEVSGNVVPALVRLITRDPVNWEKATVFPKATHILDFGPGGVSGLG
PLTSRNKEGTGVRVIVAGVVDGTTLEVGYKPELFDRDEDNIRYAIDWVKEFGPRLVKTSSGRKYVDTKMSRLLGL
PPVMVAGMTPCTVPWDFVAATMNAGYHIELAGGGYFAPSMMTAALSKIEKAIPSGRGITVNLIYVNPMAMSWQIP
LIGKLRAEGVPIEGLTIGAGVPSIEVAQEYIETLGLKHIGFKPGSVEAVHAVINIAKANPSFPVLLQWTGGRGGG
HHSFEDFHQPILQMYGRIRRQENIILVAGSGFGSAKDTYPYLTGDWAKKYGYPPMPFDGCLFGSRMMVAKEAHTS
HDAKQAIVDAPGLEDAEWENTYKGPAGGVITVRSEMGEPIHKLATRGVRFWAEMDKKIFSLPKEKRVAELKKNRE
YIIKKLNDDFQKVWFGCNKEGKAVDLEDMTYAEVVRRMVELLYVKGQSRWIDPSFCTLTGDFIHRVEERFTASPN
QPSLLQSYADLKEPFAAVDRILSHYPESETQIINAQDVQHFLMLCMRPAQKPVTFIPALDENFEFFFKKDSLWQS
EDLDAVIGQDVGRTCILQGPTAAKYSTILNEPIKDILDGIHDAHITALMRDYYDNDERAIPAVEYFGGKLVDLEI
PLDVEGLTVNYDAHKNTYRLSSSATAAMPPLDSWLSLLAGPNRSWRYALLMSDVVVQGQKFQTNPMRRIFAPVRG
LFVEILYPNEPEKTTIIVREQPRHNQYVDVIEVKLSGKNEIIVKMIKDTTALGKPTTLALKFTYHAEAGYAPIHE
VMADRNDRIKEFYWRTWFGTDNVDLDADIMGKFDGGSTIITGEAIRDFVHAVGNTGEAFVDRPGKTVYAPMDFAI
VLGWKAITKPIFPRTIDGDLLRLVHLSNQFRMIPGADPLKKGDEIINNAQINAVINQDSGKMVEVCGTVSRNGEP
VMEVTSQFLYRGTYTDYENTFQRKIETPVQVHLATSKDVAVLRSKQWFAVDEIHGEMDLLGQTLTFRLQSLMRYK
NKTVFSSVETRGQVLLELPTKEVIQVASVDYEAGESHGNPVLDYLQRHGSPLDQPIYFENPIPLSGKGPLQLRAP
ASNETYARVSGDYNPIHVSRVFSSYANLPGTITHGMYSSASVRSLVETWAAENDIGRVRSFHASLVGMVLPNDDI
EVKLQHVGMVAGRKIIKVDVSNAETEEKVLSGEAEIEQPVTTYVFTGQGSQEQGMGMELYASSPVAKEVWDRADT
YLVDNYGFSITNIVKNNPKELTIHFGGPRGKAIRQNYMAMTFETVAADGTIKSERIFKEIDDSTTSYTYRSPTGL
LSATQFTQPALTLMEKASFEDMKSKGLVQGDSTFAGHSLGEYSALAALADVMPIESLVSVVFYRGLTMQVAVERD
ASGRSNYSMCAVNPSRISKTFNEEALQFVVNMIAEEKGWLLEIVNYNIANMQYVCAGDLRALDTLAGVTNYLKKK
EIDIEEMRSNIQEAKGVLRGIIRQCSEATLKKPVPLELERGFATIPLRGIDVPFHSTFLRSGVKPFRSFLLKKIH
KTTIDPSKLVGKYIPNVTAKPFALTKEYFEDVYKLTNSPKIGVVLANWDKYSQDDDGKDGSDSGASIPYEGPGAA
A*
Coding >Ophun1|2239
ATGTACGGCACAGCGACCGGCCCTCAGACGGGCATCTCTACTCCCAGATCGAGCGCCTCTCTCCGGCCATTGACC
ATCACTCACGGCTCTCTCGAAACCTCCTTTCTCGTCCCAAGCAACCTCCACTTTCACGCCTCTCAACTCAAGGAT
CGCCTGATTGCTACTCTGCCTGAAGCGACCGATGAGCTCGCCCATGATGATGAGCCATCGTCCGTCGCCGAGCTC
GTCGCCAGGTACCTAGGCCTCGTCGCTCGTGAGGTGGAGAACGGAGAGGATGATGCCCAAGGCTCTTACGAAGAG
GTCCTCAAGCTTGTTCTCAACGAGTTCGAGAGAGCCTTTCTGCGTGGCAACGAGGTCCACGCCGTTGCTGCTGCT
CTCCCGGGCATCGAAGCCAAGAAGCTTGAGGTGATCCGGAGCTACTACCTTGCCCGGGCTGTCGCCGAAAGAACC
ATCAAGCCCCATCAGTCTGCCTTGTTGCGGGCTGCAGACGACGGTTCCGCCGAGATCTACACCATCTTCGGCGGC
CAAGGCAATATTGAGCAATACTTTGAAGAGCTTCGCGAGGTCTTCCAAACGTATCCCAGCTTCGTCGGCGAACTC
ATCATCACCGCTGCCGAGCAGCTACAGACTCTTTCCAACCACCCCGAAGCCGAAAAGATGTTTCCCAAGGGCTTG
GACGTCATGAATTGGCTTCATAACCCAGACTCCACGCCAGAAGTCGACTATCTCATCTCGGCGCCCGTCAGCTTT
CCCCTCATCGGTCTGGTCCAAATGGCACACTACGAGGTCACCTGCAAGGTGCTCGGTATTCATCCAGGCCAGTTA
CGGGATCGATTCGGCGGCACGACAGGCCATTCCCAGGGCATTGTCATGGCCGCGGCAACTGCCGCGGCGGATTCG
TGGGACTCGTGGCGCCAGATCGTCGACTCGACCCTGGCCATCCTCTTTTGGATTGGAACGCGTAGCCAACAGGCG
TTCCCTACCACGTCTCTGACGCCCACCATGTTGCGCGAGTCGCTGGACCATGGCGAGGGCACTCCTACGCCTATG
CTGAGCATCCGAGACCTTTCCCAGCAGGAGCTTCAAAAGCACATCGATGCCACGAACCAGTACCTGCCTCCTCAC
CGTCACATCAGTGTGTCGCTGGTCAACAGCCCGCGCAACCTTGTTGTCACCGGGCCCCCGATCTCACTCTATGGT
CTCAACTCACAGTTGCGCAAGGTCAAGGCCCCAACGGGCCTCGATCAGACCCGCGTGCCACACACGGAGCGCAAG
GTTCGCTTTTCGAACCGATTCCTTCCCATCACGGCCCCCTTTCACAGCAAGTATCTTGCAGACGCAACCGCCATG
ATCGACGAGGATCTCAAGAATATCCGCATCGAATCCAGTTCCTTGGGGATCCCCGTCTTTGACACCAACAATGGC
AAGGATCTTCGGTCCGAAGTCAGCGGCAACGTTGTTCCGGCCCTGGTGCGCCTCATCACCCGCGATCCCGTCAAC
TGGGAGAAGGCCACCGTCTTTCCAAAGGCCACGCACATTCTGGACTTTGGCCCCGGCGGCGTGTCTGGCCTTGGC
CCCCTGACCAGCCGCAACAAAGAAGGGACCGGTGTTCGAGTGATTGTCGCCGGTGTCGTCGACGGCACCACTCTC
GAGGTCGGTTACAAGCCTGAGCTCTTCGATAGGGACGAGGACAATATCAGGTACGCCATCGACTGGGTCAAGGAG
TTTGGCCCTCGTCTGGTCAAAACGTCGAGTGGACGCAAGTACGTCGACACCAAGATGAGCCGCCTGCTGGGCTTG
CCTCCTGTCATGGTGGCCGGCATGACCCCTTGCACCGTGCCGTGGGACTTTGTCGCGGCAACCATGAATGCGGGC
TATCACATCGAACTCGCCGGTGGAGGCTACTTTGCCCCGAGCATGATGACGGCCGCCCTGTCCAAGATCGAGAAA
GCCATCCCGTCGGGCCGCGGCATCACCGTCAACTTGATATACGTCAACCCCATGGCTATGAGCTGGCAGATCCCG
CTCATTGGCAAATTACGAGCAGAGGGCGTGCCGATTGAGGGCTTGACCATCGGTGCCGGAGTTCCTTCCATTGAG
GTCGCGCAAGAGTACATCGAGACGTTGGGCCTAAAGCACATCGGCTTCAAGCCCGGCTCCGTCGAAGCTGTTCAT
GCCGTCATCAACATTGCCAAGGCTAACCCGAGCTTCCCGGTCCTCCTGCAGTGGACCGGCGGCCGGGGCGGCGGT
CACCACTCTTTCGAAGACTTCCACCAGCCCATACTCCAGATGTACGGTCGCATCCGACGTCAGGAGAACATCATT
CTCGTTGCTGGCAGTGGTTTCGGAAGTGCCAAAGACACGTACCCCTACCTTACGGGTGACTGGGCCAAGAAGTAT
GGCTACCCCCCCATGCCTTTCGATGGCTGCCTCTTTGGCAGCCGCATGATGGTGGCAAAGGAAGCACATACGAGC
CACGACGCAAAGCAAGCCATTGTGGACGCCCCCGGCTTGGAAGATGCTGAGTGGGAGAACACGTACAAGGGACCC
GCTGGCGGCGTCATCACCGTTCGGTCGGAGATGGGCGAGCCCATTCACAAGCTCGCAACCAGAGGCGTGCGTTTC
TGGGCCGAGATGGACAAGAAGATCTTCAGCTTGCCCAAGGAAAAGAGGGTGGCAGAGCTGAAGAAGAACCGGGAG
TACATCATCAAGAAGCTCAACGACGACTTTCAGAAGGTCTGGTTCGGCTGCAATAAGGAAGGCAAGGCCGTCGAC
CTCGAGGATATGACGTACGCCGAGGTTGTGCGCCGCATGGTCGAGCTGCTCTATGTGAAGGGTCAAAGTCGATGG
ATCGACCCGTCCTTTTGCACGCTCACTGGCGACTTCATTCATCGCGTCGAGGAACGCTTCACCGCGTCTCCCAAC
CAACCGTCGTTGCTGCAGAGCTATGCCGACCTCAAGGAGCCTTTCGCTGCTGTCGACAGGATTCTCTCTCACTAC
CCCGAGTCGGAGACGCAGATCATCAACGCACAGGATGTCCAGCACTTCCTTATGCTGTGCATGCGACCGGCTCAG
AAGCCCGTCACCTTCATCCCGGCTTTGGATGAGAACTTTGAGTTCTTCTTCAAGAAGGACTCTCTTTGGCAGTCG
GAAGATCTCGACGCCGTCATCGGCCAAGATGTCGGCCGTACGTGTATCCTCCAGGGCCCGACGGCGGCCAAATAC
TCGACCATTCTGAATGAGCCCATAAAGGACATTCTTGACGGCATCCACGATGCTCATATCACCGCGTTGATGAGA
GACTACTACGATAACGACGAGCGCGCTATCCCAGCCGTCGAGTACTTCGGCGGCAAGCTGGTGGACCTCGAGATT
CCGCTCGACGTCGAGGGGCTGACCGTCAACTACGACGCTCACAAGAACACATACCGCTTGTCATCTTCGGCCACC
GCCGCCATGCCCCCCCTCGACTCCTGGCTCTCTCTTTTGGCCGGCCCTAACCGTAGCTGGCGATATGCGTTGTTG
ATGTCGGACGTCGTCGTTCAGGGCCAGAAATTCCAGACCAACCCCATGCGACGCATCTTTGCGCCCGTTCGCGGT
CTGTTTGTGGAAATTCTCTACCCCAATGAGCCAGAGAAGACGACCATCATCGTTCGGGAGCAGCCCAGGCACAAC
CAGTACGTCGACGTCATCGAAGTGAAATTGAGTGGGAAGAACGAGATTATCGTGAAGATGATCAAAGATACGACG
GCTCTGGGCAAGCCAACAACCTTGGCACTCAAGTTCACGTATCACGCTGAGGCCGGTTACGCCCCCATCCACGAA
GTCATGGCGGATCGCAACGATCGCATCAAGGAGTTCTACTGGCGCACCTGGTTTGGCACCGACAATGTTGATCTC
GACGCTGACATCATGGGCAAGTTTGATGGAGGCAGCACCATTATTACCGGCGAGGCCATCAGGGACTTCGTGCAT
GCCGTCGGCAACACCGGTGAGGCGTTCGTTGACAGGCCGGGAAAGACCGTCTACGCTCCCATGGACTTTGCCATC
GTCTTGGGCTGGAAGGCCATCACCAAGCCCATCTTCCCGCGCACCATCGACGGCGATCTGCTCAGGCTCGTCCAT
CTTTCGAACCAGTTCCGCATGATTCCTGGAGCGGACCCCCTGAAGAAGGGCGACGAGATCATCAATAACGCCCAG
ATCAACGCCGTCATCAACCAAGACTCGGGCAAGATGGTCGAGGTCTGCGGCACCGTTTCTCGAAACGGCGAACCG
GTCATGGAGGTGACGTCGCAGTTCCTGTATCGCGGAACGTACACCGACTACGAAAACACGTTCCAGCGCAAGATC
GAGACTCCAGTGCAGGTCCATCTGGCTACGAGCAAGGACGTGGCCGTCCTCCGGTCGAAGCAGTGGTTTGCCGTG
GACGAGATTCACGGCGAAATGGACTTGCTCGGCCAGACACTGACGTTCCGGCTGCAGAGTCTTATGCGCTACAAG
AACAAGACCGTGTTCAGCAGTGTCGAGACTCGCGGCCAGGTTCTGCTGGAGTTGCCGACCAAGGAGGTCATTCAG
GTGGCGAGCGTCGACTACGAAGCGGGCGAGTCTCATGGAAACCCCGTCTTGGACTACCTGCAGAGACACGGGTCG
CCGCTGGATCAGCCCATCTACTTTGAGAACCCGATTCCCCTGAGCGGCAAAGGGCCACTGCAGCTGCGCGCGCCG
GCCTCCAACGAGACGTACGCTCGCGTCTCCGGGGACTACAACCCCATTCACGTCTCACGCGTCTTCTCGAGCTAC
GCGAATCTGCCAGGTACCATCACGCATGGCATGTACTCGAGTGCCTCCGTCCGGAGTCTCGTCGAGACATGGGCT
GCCGAGAACGACATTGGCCGGGTGCGAAGCTTCCACGCGTCCTTGGTCGGCATGGTTCTCCCCAATGACGACATT
GAGGTCAAGCTGCAGCACGTCGGAATGGTAGCTGGCCGCAAGATCATCAAGGTCGATGTCAGCAACGCGGAGACG
GAGGAGAAGGTGCTCTCCGGCGAGGCCGAAATTGAGCAACCCGTGACGACGTACGTGTTCACCGGGCAGGGATCA
CAGGAGCAGGGCATGGGCATGGAACTGTACGCGAGCAGCCCCGTGGCCAAGGAAGTCTGGGATCGCGCGGACACG
TATCTGGTCGACAACTATGGCTTCTCAATTACCAACATCGTCAAGAACAACCCCAAGGAACTCACAATCCACTTT
GGAGGGCCGAGAGGTAAGGCTATCAGGCAGAACTACATGGCCATGACATTCGAGACGGTGGCCGCAGATGGGACC
ATCAAGTCGGAGCGCATCTTCAAGGAAATCGACGACAGCACGACCTCGTACACGTACCGGTCGCCCACCGGACTG
CTGTCGGCGACACAGTTTACGCAGCCTGCGCTGACGCTGATGGAAAAGGCCAGCTTCGAGGACATGAAGTCCAAG
GGCCTCGTTCAAGGAGACAGCACGTTTGCCGGCCACTCGCTGGGAGAGTACTCCGCTCTGGCGGCATTGGCGGAC
GTGATGCCCATCGAGTCGCTGGTCTCCGTCGTTTTCTACAGGGGCTTGACGATGCAGGTGGCCGTGGAGCGCGAC
GCCAGCGGGCGATCCAATTACTCCATGTGCGCCGTGAACCCCAGCCGCATCTCCAAGACGTTCAACGAGGAGGCG
CTGCAGTTCGTCGTCAACATGATCGCGGAAGAGAAGGGCTGGCTTCTGGAGATTGTCAACTACAACATCGCCAAC
ATGCAGTACGTCTGCGCAGGCGACCTCAGGGCGCTCGACACGCTTGCCGGAGTCACCAACTACCTCAAGAAGAAG
GAGATTGACATTGAGGAGATGCGGAGCAACATCCAGGAGGCCAAGGGAGTGCTGCGAGGAATCATCCGTCAATGC
TCCGAGGCGACGCTCAAGAAGCCGGTGCCTCTGGAGCTGGAACGAGGGTTTGCCACCATTCCGCTGCGAGGCATC
GACGTGCCTTTCCACTCGACCTTTTTGCGGTCCGGCGTCAAGCCGTTCCGGTCTTTCCTGCTCAAGAAGATCCAC
AAGACGACAATCGACCCGTCGAAGCTGGTTGGGAAATACATTCCCAATGTGACGGCCAAGCCATTTGCGCTCACC
AAGGAGTACTTTGAGGACGTGTATAAGCTGACCAACTCGCCCAAGATCGGGGTCGTGCTGGCCAACTGGGACAAG
TACTCGCAGGATGACGATGGCAAGGACGGCAGTGACAGCGGCGCGAGCATCCCCTACGAGGGTCCAGGCGCGGCC
GCTTGA
Transcript >Ophun1|2239
ATGTACGGCACAGCGACCGGCCCTCAGACGGGCATCTCTACTCCCAGATCGAGCGCCTCTCTCCGGCCATTGACC
ATCACTCACGGCTCTCTCGAAACCTCCTTTCTCGTCCCAAGCAACCTCCACTTTCACGCCTCTCAACTCAAGGAT
CGCCTGATTGCTACTCTGCCTGAAGCGACCGATGAGCTCGCCCATGATGATGAGCCATCGTCCGTCGCCGAGCTC
GTCGCCAGGTACCTAGGCCTCGTCGCTCGTGAGGTGGAGAACGGAGAGGATGATGCCCAAGGCTCTTACGAAGAG
GTCCTCAAGCTTGTTCTCAACGAGTTCGAGAGAGCCTTTCTGCGTGGCAACGAGGTCCACGCCGTTGCTGCTGCT
CTCCCGGGCATCGAAGCCAAGAAGCTTGAGGTGATCCGGAGCTACTACCTTGCCCGGGCTGTCGCCGAAAGAACC
ATCAAGCCCCATCAGTCTGCCTTGTTGCGGGCTGCAGACGACGGTTCCGCCGAGATCTACACCATCTTCGGCGGC
CAAGGCAATATTGAGCAATACTTTGAAGAGCTTCGCGAGGTCTTCCAAACGTATCCCAGCTTCGTCGGCGAACTC
ATCATCACCGCTGCCGAGCAGCTACAGACTCTTTCCAACCACCCCGAAGCCGAAAAGATGTTTCCCAAGGGCTTG
GACGTCATGAATTGGCTTCATAACCCAGACTCCACGCCAGAAGTCGACTATCTCATCTCGGCGCCCGTCAGCTTT
CCCCTCATCGGTCTGGTCCAAATGGCACACTACGAGGTCACCTGCAAGGTGCTCGGTATTCATCCAGGCCAGTTA
CGGGATCGATTCGGCGGCACGACAGGCCATTCCCAGGGCATTGTCATGGCCGCGGCAACTGCCGCGGCGGATTCG
TGGGACTCGTGGCGCCAGATCGTCGACTCGACCCTGGCCATCCTCTTTTGGATTGGAACGCGTAGCCAACAGGCG
TTCCCTACCACGTCTCTGACGCCCACCATGTTGCGCGAGTCGCTGGACCATGGCGAGGGCACTCCTACGCCTATG
CTGAGCATCCGAGACCTTTCCCAGCAGGAGCTTCAAAAGCACATCGATGCCACGAACCAGTACCTGCCTCCTCAC
CGTCACATCAGTGTGTCGCTGGTCAACAGCCCGCGCAACCTTGTTGTCACCGGGCCCCCGATCTCACTCTATGGT
CTCAACTCACAGTTGCGCAAGGTCAAGGCCCCAACGGGCCTCGATCAGACCCGCGTGCCACACACGGAGCGCAAG
GTTCGCTTTTCGAACCGATTCCTTCCCATCACGGCCCCCTTTCACAGCAAGTATCTTGCAGACGCAACCGCCATG
ATCGACGAGGATCTCAAGAATATCCGCATCGAATCCAGTTCCTTGGGGATCCCCGTCTTTGACACCAACAATGGC
AAGGATCTTCGGTCCGAAGTCAGCGGCAACGTTGTTCCGGCCCTGGTGCGCCTCATCACCCGCGATCCCGTCAAC
TGGGAGAAGGCCACCGTCTTTCCAAAGGCCACGCACATTCTGGACTTTGGCCCCGGCGGCGTGTCTGGCCTTGGC
CCCCTGACCAGCCGCAACAAAGAAGGGACCGGTGTTCGAGTGATTGTCGCCGGTGTCGTCGACGGCACCACTCTC
GAGGTCGGTTACAAGCCTGAGCTCTTCGATAGGGACGAGGACAATATCAGGTACGCCATCGACTGGGTCAAGGAG
TTTGGCCCTCGTCTGGTCAAAACGTCGAGTGGACGCAAGTACGTCGACACCAAGATGAGCCGCCTGCTGGGCTTG
CCTCCTGTCATGGTGGCCGGCATGACCCCTTGCACCGTGCCGTGGGACTTTGTCGCGGCAACCATGAATGCGGGC
TATCACATCGAACTCGCCGGTGGAGGCTACTTTGCCCCGAGCATGATGACGGCCGCCCTGTCCAAGATCGAGAAA
GCCATCCCGTCGGGCCGCGGCATCACCGTCAACTTGATATACGTCAACCCCATGGCTATGAGCTGGCAGATCCCG
CTCATTGGCAAATTACGAGCAGAGGGCGTGCCGATTGAGGGCTTGACCATCGGTGCCGGAGTTCCTTCCATTGAG
GTCGCGCAAGAGTACATCGAGACGTTGGGCCTAAAGCACATCGGCTTCAAGCCCGGCTCCGTCGAAGCTGTTCAT
GCCGTCATCAACATTGCCAAGGCTAACCCGAGCTTCCCGGTCCTCCTGCAGTGGACCGGCGGCCGGGGCGGCGGT
CACCACTCTTTCGAAGACTTCCACCAGCCCATACTCCAGATGTACGGTCGCATCCGACGTCAGGAGAACATCATT
CTCGTTGCTGGCAGTGGTTTCGGAAGTGCCAAAGACACGTACCCCTACCTTACGGGTGACTGGGCCAAGAAGTAT
GGCTACCCCCCCATGCCTTTCGATGGCTGCCTCTTTGGCAGCCGCATGATGGTGGCAAAGGAAGCACATACGAGC
CACGACGCAAAGCAAGCCATTGTGGACGCCCCCGGCTTGGAAGATGCTGAGTGGGAGAACACGTACAAGGGACCC
GCTGGCGGCGTCATCACCGTTCGGTCGGAGATGGGCGAGCCCATTCACAAGCTCGCAACCAGAGGCGTGCGTTTC
TGGGCCGAGATGGACAAGAAGATCTTCAGCTTGCCCAAGGAAAAGAGGGTGGCAGAGCTGAAGAAGAACCGGGAG
TACATCATCAAGAAGCTCAACGACGACTTTCAGAAGGTCTGGTTCGGCTGCAATAAGGAAGGCAAGGCCGTCGAC
CTCGAGGATATGACGTACGCCGAGGTTGTGCGCCGCATGGTCGAGCTGCTCTATGTGAAGGGTCAAAGTCGATGG
ATCGACCCGTCCTTTTGCACGCTCACTGGCGACTTCATTCATCGCGTCGAGGAACGCTTCACCGCGTCTCCCAAC
CAACCGTCGTTGCTGCAGAGCTATGCCGACCTCAAGGAGCCTTTCGCTGCTGTCGACAGGATTCTCTCTCACTAC
CCCGAGTCGGAGACGCAGATCATCAACGCACAGGATGTCCAGCACTTCCTTATGCTGTGCATGCGACCGGCTCAG
AAGCCCGTCACCTTCATCCCGGCTTTGGATGAGAACTTTGAGTTCTTCTTCAAGAAGGACTCTCTTTGGCAGTCG
GAAGATCTCGACGCCGTCATCGGCCAAGATGTCGGCCGTACGTGTATCCTCCAGGGCCCGACGGCGGCCAAATAC
TCGACCATTCTGAATGAGCCCATAAAGGACATTCTTGACGGCATCCACGATGCTCATATCACCGCGTTGATGAGA
GACTACTACGATAACGACGAGCGCGCTATCCCAGCCGTCGAGTACTTCGGCGGCAAGCTGGTGGACCTCGAGATT
CCGCTCGACGTCGAGGGGCTGACCGTCAACTACGACGCTCACAAGAACACATACCGCTTGTCATCTTCGGCCACC
GCCGCCATGCCCCCCCTCGACTCCTGGCTCTCTCTTTTGGCCGGCCCTAACCGTAGCTGGCGATATGCGTTGTTG
ATGTCGGACGTCGTCGTTCAGGGCCAGAAATTCCAGACCAACCCCATGCGACGCATCTTTGCGCCCGTTCGCGGT
CTGTTTGTGGAAATTCTCTACCCCAATGAGCCAGAGAAGACGACCATCATCGTTCGGGAGCAGCCCAGGCACAAC
CAGTACGTCGACGTCATCGAAGTGAAATTGAGTGGGAAGAACGAGATTATCGTGAAGATGATCAAAGATACGACG
GCTCTGGGCAAGCCAACAACCTTGGCACTCAAGTTCACGTATCACGCTGAGGCCGGTTACGCCCCCATCCACGAA
GTCATGGCGGATCGCAACGATCGCATCAAGGAGTTCTACTGGCGCACCTGGTTTGGCACCGACAATGTTGATCTC
GACGCTGACATCATGGGCAAGTTTGATGGAGGCAGCACCATTATTACCGGCGAGGCCATCAGGGACTTCGTGCAT
GCCGTCGGCAACACCGGTGAGGCGTTCGTTGACAGGCCGGGAAAGACCGTCTACGCTCCCATGGACTTTGCCATC
GTCTTGGGCTGGAAGGCCATCACCAAGCCCATCTTCCCGCGCACCATCGACGGCGATCTGCTCAGGCTCGTCCAT
CTTTCGAACCAGTTCCGCATGATTCCTGGAGCGGACCCCCTGAAGAAGGGCGACGAGATCATCAATAACGCCCAG
ATCAACGCCGTCATCAACCAAGACTCGGGCAAGATGGTCGAGGTCTGCGGCACCGTTTCTCGAAACGGCGAACCG
GTCATGGAGGTGACGTCGCAGTTCCTGTATCGCGGAACGTACACCGACTACGAAAACACGTTCCAGCGCAAGATC
GAGACTCCAGTGCAGGTCCATCTGGCTACGAGCAAGGACGTGGCCGTCCTCCGGTCGAAGCAGTGGTTTGCCGTG
GACGAGATTCACGGCGAAATGGACTTGCTCGGCCAGACACTGACGTTCCGGCTGCAGAGTCTTATGCGCTACAAG
AACAAGACCGTGTTCAGCAGTGTCGAGACTCGCGGCCAGGTTCTGCTGGAGTTGCCGACCAAGGAGGTCATTCAG
GTGGCGAGCGTCGACTACGAAGCGGGCGAGTCTCATGGAAACCCCGTCTTGGACTACCTGCAGAGACACGGGTCG
CCGCTGGATCAGCCCATCTACTTTGAGAACCCGATTCCCCTGAGCGGCAAAGGGCCACTGCAGCTGCGCGCGCCG
GCCTCCAACGAGACGTACGCTCGCGTCTCCGGGGACTACAACCCCATTCACGTCTCACGCGTCTTCTCGAGCTAC
GCGAATCTGCCAGGTACCATCACGCATGGCATGTACTCGAGTGCCTCCGTCCGGAGTCTCGTCGAGACATGGGCT
GCCGAGAACGACATTGGCCGGGTGCGAAGCTTCCACGCGTCCTTGGTCGGCATGGTTCTCCCCAATGACGACATT
GAGGTCAAGCTGCAGCACGTCGGAATGGTAGCTGGCCGCAAGATCATCAAGGTCGATGTCAGCAACGCGGAGACG
GAGGAGAAGGTGCTCTCCGGCGAGGCCGAAATTGAGCAACCCGTGACGACGTACGTGTTCACCGGGCAGGGATCA
CAGGAGCAGGGCATGGGCATGGAACTGTACGCGAGCAGCCCCGTGGCCAAGGAAGTCTGGGATCGCGCGGACACG
TATCTGGTCGACAACTATGGCTTCTCAATTACCAACATCGTCAAGAACAACCCCAAGGAACTCACAATCCACTTT
GGAGGGCCGAGAGGTAAGGCTATCAGGCAGAACTACATGGCCATGACATTCGAGACGGTGGCCGCAGATGGGACC
ATCAAGTCGGAGCGCATCTTCAAGGAAATCGACGACAGCACGACCTCGTACACGTACCGGTCGCCCACCGGACTG
CTGTCGGCGACACAGTTTACGCAGCCTGCGCTGACGCTGATGGAAAAGGCCAGCTTCGAGGACATGAAGTCCAAG
GGCCTCGTTCAAGGAGACAGCACGTTTGCCGGCCACTCGCTGGGAGAGTACTCCGCTCTGGCGGCATTGGCGGAC
GTGATGCCCATCGAGTCGCTGGTCTCCGTCGTTTTCTACAGGGGCTTGACGATGCAGGTGGCCGTGGAGCGCGAC
GCCAGCGGGCGATCCAATTACTCCATGTGCGCCGTGAACCCCAGCCGCATCTCCAAGACGTTCAACGAGGAGGCG
CTGCAGTTCGTCGTCAACATGATCGCGGAAGAGAAGGGCTGGCTTCTGGAGATTGTCAACTACAACATCGCCAAC
ATGCAGTACGTCTGCGCAGGCGACCTCAGGGCGCTCGACACGCTTGCCGGAGTCACCAACTACCTCAAGAAGAAG
GAGATTGACATTGAGGAGATGCGGAGCAACATCCAGGAGGCCAAGGGAGTGCTGCGAGGAATCATCCGTCAATGC
TCCGAGGCGACGCTCAAGAAGCCGGTGCCTCTGGAGCTGGAACGAGGGTTTGCCACCATTCCGCTGCGAGGCATC
GACGTGCCTTTCCACTCGACCTTTTTGCGGTCCGGCGTCAAGCCGTTCCGGTCTTTCCTGCTCAAGAAGATCCAC
AAGACGACAATCGACCCGTCGAAGCTGGTTGGGAAATACATTCCCAATGTGACGGCCAAGCCATTTGCGCTCACC
AAGGAGTACTTTGAGGACGTGTATAAGCTGACCAACTCGCCCAAGATCGGGGTCGTGCTGGCCAACTGGGACAAG
TACTCGCAGGATGACGATGGCAAGGACGGCAGTGACAGCGGCGCGAGCATCCCCTACGAGGGTCCAGGCGCGGCC
GCTTGA
Gene >Ophun1|2239
ATGTACGGCACAGCGACCGGCCCTCAGACGGGCATCTCTACTCCCAGATCGAGCGCCTCTCTCCGGCCATTGACC
ATCACTCACGGCTCTCTCGAAACCTCCTTTCTCGTCCCAAGCAACCTCCACTTTCACGCCTCTCAACTCAAGGAT
CGCCTGATTGCTACTCTGCCTGAAGCGACCGATGAGCTCGCCCATGATGATGAGCCATCGTCCGTCGCCGAGCTC
GTCGCCAGGTACCTAGGCCTCGTCGCTCGTGAGGTGGAGAACGGAGAGGATGATGCCCAAGGCTCTTACGAAGAG
GTCCTCAAGCTTGTTCTCAACGAGTTCGAGAGAGCCTTTCTGCGTGGCAACGAGGTCCACGCCGTTGCTGCTGCT
CTCCCGGGCATCGAAGCCAAGAAGCTTGAGGTGATCCGGAGCTACTACCTTGCCCGGGCTGTCGCCGAAAGAACC
ATCAAGCCCCATCAGTCTGCCTTGTTGCGGGCTGCAGACGACGGTTCCGCCGAGATCTACACCATCTTCGGCGGC
CAAGGCAATATTGAGCAATACTTTGAAGAGCTTCGCGAGGTCTTCCAAACGTATCCCAGCTTCGTCGGCGAACTC
ATCATCACCGCTGCCGAGCAGCTACAGACTCTTTCCAACCACCCCGAAGCCGAAAAGATGTTTCCCAAGGGCTTG
GACGTCATGAATTGGCTTCATAACCCAGACTCCACGCCAGAAGTCGACTATCTCATCTCGGCGCCCGTCAGCTTT
CCCCTCATCGGTCTGGTCCAAATGGCACACTACGAGGTCACCTGCAAGGTGCTCGGTATTCATCCAGGCCAGTTA
CGGGATCGATTCGGCGGCACGACAGGCCATTCCCAGGGCATTGTCATGGCCGCGGCAACTGCCGCGGCGGATTCG
TGGGACTCGTGGCGCCAGATCGTCGACTCGACCCTGGCCATCCTCTTTTGGATTGGAACGCGTAGCCAACAGGCG
TTCCCTACCACGTCTCTGACGCCCACCATGTTGCGCGAGTCGCTGGACCATGGCGAGGGCACTCCTACGCCTATG
CTGAGCATCCGAGACCTTTCCCAGCAGGAGCTTCAAAAGCACATCGATGCCACGAACCAGTACCTGCCTCCTCAC
CGTCACATCAGTGTGTCGCTGGTCAACAGCCCGCGCAACCTTGTTGTCACCGGGCCCCCGATCTCACTCTATGGT
CTCAACTCACAGTTGCGCAAGGTCAAGGCCCCAACGGGCCTCGATCAGACCCGCGTGCCACACACGGAGCGCAAG
GTTCGCTTTTCGAACCGATTCCTTCCCATCACGGCCCCCTTTCACAGCAAGTATCTTGCAGACGCAACCGCCATG
ATCGACGAGGATCTCAAGAATATCCGCATCGAATCCAGTTCCTTGGGGATCCCCGTCTTTGACACCAACAATGGC
AAGGATCTTCGGTCCGAAGTCAGCGGCAACGTTGTTCCGGCCCTGGTGCGCCTCATCACCCGCGATCCCGTCAAC
TGGGAGAAGGCCACCGTCTTTCCAAAGGCCACGCACATTCTGGACTTTGGCCCCGGCGGCGTGTCTGGCCTTGGC
CCCCTGACCAGCCGCAACAAAGAAGGGACCGGTGTTCGAGTGATTGTCGCCGGTGTCGTCGACGGCACCACTCTC
GAGGTCGGTTACAAGCCTGAGCTCTTCGATAGGGACGAGGACAATATCAGGTACGCCATCGACTGGGTCAAGGAG
TTTGGCCCTCGTCTGGTCAAAACGTCGAGTGGACGCAAGTACGTCGACACCAAGATGAGCCGCCTGCTGGGCTTG
CCTCCTGTCATGGTGGCCGGCATGACCCCTTGCACCGTGCCGTGGGACTTTGTCGCGGCAACCATGAATGCGGGC
TATCACATCGAACTCGCCGGTGGAGGCTACTTTGCCCCGAGCATGATGACGGCCGCCCTGTCCAAGATCGAGAAA
GCCATCCCGTCGGGCCGCGGCATCACCGTCAACTTGATATACGTCAACCCCATGGCTATGAGCTGGCAGATCCCG
CTCATTGGCAAATTACGAGCAGAGGGCGTGCCGATTGAGGGCTTGACCATCGGTGCCGGAGTTCCTTCCATTGAG
GTCGCGCAAGAGTACATCGAGACGTTGGGCCTAAAGCACATCGGCTTCAAGCCCGGCTCCGTCGAAGCTGTTCAT
GCCGTCATCAACATTGCCAAGGCTAACCCGAGCTTCCCGGTCCTCCTGCAGTGGACCGGCGGCCGGGGCGGCGGT
CACCACTCTTTCGAAGACTTCCACCAGCCCATACTCCAGATGTACGGTCGCATCCGACGTCAGGAGAACATCATT
CTCGTTGCTGGCAGTGGTTTCGGAAGTGCCAAAGACACGTACCCCTACCTTACGGGTGACTGGGCCAAGAAGTAT
GGCTACCCCCCCATGCCTTTCGATGGCTGCCTCTTTGGCAGCCGCATGATGGTGGCAAAGGAAGCACATACGAGC
CACGACGCAAAGCAAGCCATTGTGGACGCCCCCGGCTTGGAAGATGCTGAGTGGGAGAACACGTACAAGGGACCC
GCTGGCGGCGTCATCACCGTTCGGTCGGAGATGGGCGAGCCCATTCACAAGCTCGCAACCAGAGGCGTGCGTTTC
TGGGCCGAGATGGACAAGAAGATCTTCAGCTTGCCCAAGGAAAAGAGGGTGGCAGAGCTGAAGAAGAACCGGGAG
TACATCATCAAGAAGCTCAACGACGACTTTCAGAAGGTCTGGTTCGGCTGCAATAAGGAAGGCAAGGCCGTCGAC
CTCGAGGATATGACGTACGCCGAGGTTGTGCGCCGCATGGTCGAGCTGCTCTATGTGAAGGGTCAAAGTCGATGG
ATCGACCCGTCCTTTTGCACGCTCACTGGCGACTTCATTCATCGCGTCGAGGAACGCTTCACCGCGTCTCCCAAC
CAACCGTCGTTGCTGCAGAGCTATGCCGACCTCAAGGAGCCTTTCGCTGCTGTCGACAGGATTCTCTCTCACTAC
CCCGAGTCGGAGACGCAGATCATCAACGCACAGGATGTCCAGCACTTCCTTATGCTGTGCATGCGACCGGCTCAG
AAGCCCGTCACCTTCATCCCGGCTTTGGATGAGAACTTTGAGTTCTTCTTCAAGAAGGACTCTCTTTGGCAGTCG
GAAGATCTCGACGCCGTCATCGGCCAAGATGTCGGCCGTACGTGTATCCTCCAGGGCCCGACGGCGGCCAAATAC
TCGACCATTCTGAATGAGCCCATAAAGGACATTCTTGACGGCATCCACGATGCTCATATCACCGCGTTGATGAGA
GACTACTACGATAACGACGAGCGCGCTATCCCAGCCGTCGAGTACTTCGGCGGCAAGCTGGTGGACCTCGAGATT
CCGCTCGACGTCGAGGGGCTGACCGTCAACTACGACGCTCACAAGAACACATACCGCTTGTCATCTTCGGCCACC
GCCGCCATGCCCCCCCTCGACTCCTGGCTCTCTCTTTTGGCCGGCCCTAACCGTAGCTGGCGATATGCGTTGTTG
ATGTCGGACGTCGTCGTTCAGGGCCAGAAATTCCAGACCAACCCCATGCGACGCATCTTTGCGCCCGTTCGCGGT
CTGTTTGTGGAAATTCTCTACCCCAATGAGCCAGAGAAGACGACCATCATCGTTCGGGAGCAGCCCAGGCACAAC
CAGTACGTCGACGTCATCGAAGTGAAATTGAGTGGGAAGAACGAGATTATCGTGAAGATGATCAAAGATACGACG
GCTCTGGGCAAGCCAACAACCTTGGCACTCAAGTTCACGTATCACGCTGAGGCCGGTTACGCCCCCATCCACGAA
GTCATGGCGGATCGCAACGATCGCATCAAGGAGTTCTACTGGCGCACCTGGTTTGGCACCGACAATGTTGATCTC
GACGCTGACATCATGGGCAAGTTTGATGGAGGCAGCACCATTATTACCGGCGAGGCCATCAGGGACTTCGTGCAT
GCCGTCGGCAACACCGGTGAGGCGTTCGTTGACAGGCCGGGAAAGACCGTCTACGCTCCCATGGACTTTGCCATC
GTCTTGGGCTGGAAGGCCATCACCAAGCCCATCTTCCCGCGCACCATCGACGGCGATCTGCTCAGGCTCGTCCAT
CTTTCGAACCAGTTCCGCATGATTCCTGGAGCGGACCCCCTGAAGAAGGGCGACGAGATCATCAATAACGCCCAG
ATCAACGCCGTCATCAACCAAGACTCGGGCAAGATGGTCGAGGTCTGCGGCACCGTTTCTCGAAACGGCGAACCG
GTCATGGAGGTGACGTCGCAGTTCCTGTATCGCGGAACGTACACCGACTACGAAAACACGTTCCAGCGCAAGATC
GAGACTCCAGTGCAGGTCCATCTGGCTACGAGCAAGGACGTGGCCGTCCTCCGGTCGAAGCAGTGGTTTGCCGTG
GACGAGATTCACGGCGAAATGGACTTGCTCGGCCAGACACTGACGTTCCGGCTGCAGAGTCTTATGCGCTACAAG
AACAAGACCGTGTTCAGCAGTGTCGAGACTCGCGGCCAGGTTCTGCTGGAGTTGCCGACCAAGGAGGTCATTCAG
GTGGCGAGCGTCGACTACGAAGCGGGCGAGTCTCATGGAAACCCCGTCTTGGACTACCTGCAGAGACACGGGTCG
CCGCTGGATCAGCCCATCTACTTTGAGAACCCGATTCCCCTGAGCGGCAAAGGGCCACTGCAGCTGCGCGCGCCG
GCCTCCAACGAGACGTACGCTCGCGTCTCCGGGGACTACAACCCCATTCACGTCTCACGCGTCTTCTCGAGCTAC
GCGAATCTGCCAGGTACCATCACGCATGGCATGTACTCGAGTGCCTCCGTCCGGAGTCTCGTCGAGACATGGGCT
GCCGAGAACGACATTGGCCGGGTGCGAAGCTTCCACGCGTCCTTGGTCGGCATGGTTCTCCCCAATGACGACATT
GAGGTCAAGCTGCAGCACGTCGGAATGGTAGCTGGCCGCAAGATCATCAAGGTCGATGTCAGCAACGCGGAGACG
GAGGAGAAGGTGCTCTCCGGCGAGGCCGAAATTGAGCAACCCGTGACGACGTACGTGTTCACCGGGCAGGGATCA
CAGGAGCAGGGCATGGGCATGGAACTGTACGCGAGCAGCCCCGTGGCCAAGGAAGTCTGGGATCGCGCGGACACG
TATCTGGTCGACAACTATGGTGAGTGTCCTCGGATGTGGCCTCGTGGCCGTTCGCTGGCTTGACGGGGAGGGACC
GAGACTGACTTGGCTATTTCCAGGCTTCTCAATTACCAACATCGTCAAGAACAACCCCAAGGAACTCACAATCCA
CTTTGGAGGGCCGAGAGGTAAGGCTATCAGGCAGAACTACATGGCCATGACATTCGAGACGGTGGCCGCAGATGG
GACCATCAAGTCGGAGCGCATCTTCAAGGAAATCGACGACAGCACGACCTCGTACACGTACCGGTCGCCCACCGG
ACTGCTGTCGGCGACACAGTTTACGCAGCCTGCGCTGACGCTGATGGAAAAGGCCAGCTTCGAGGACATGAAGTC
CAAGGGCCTCGTTCAAGGAGACAGCACGTTTGCCGGCCACTCGCTGGGAGAGTACTCCGCTCTGGCGGCATTGGC
GGACGTGATGCCCATCGAGTCGCTGGTCTCCGTCGTTTTCTACAGGGGCTTGACGATGCAGGTGGCCGTGGAGCG
CGACGCCAGCGGGCGATCCAATTACTCCATGTGCGCCGTGAACCCCAGCCGCATCTCCAAGACGTTCAACGAGGA
GGCGCTGCAGTTCGTCGTCAACATGATCGCGGAAGAGAAGGGCTGGCTTCTGGAGATTGTCAACTACAACATCGC
CAACATGCAGTACGTCTGCGCAGGCGACCTCAGGGCGCTCGACACGCTTGCCGGAGTCACCAACTACCTCAAGAA
GAAGGAGATTGACATTGAGGAGATGCGGAGCAACATCCAGGAGGCCAAGGGAGTGCTGCGAGGAATCATCCGTCA
ATGCTCCGAGGCGACGCTCAAGAAGCCGGTGCCTCTGGAGCTGGAACGAGGGTTTGCCACCATTCCGCTGCGAGG
CATCGACGTGCCTTTCCACTCGACCTTTTTGCGGTCCGGCGTCAAGCCGTTCCGGTCTTTCCTGCTCAAGAAGAT
CCACAAGACGACAATCGACCCGTCGAAGCTGGTTGGGAAATACATTCCCAATGTGACGGCCAAGCCATTTGCGCT
CACCAAGGAGTACTTTGAGGACGTGTATAAGCTGACCAACTCGCCCAAGATCGGGGTCGTGCTGGCCAACTGGGA
CAAGTACTCGCAGGATGACGATGGCAAGGACGGCAGTGACAGCGGCGCGAGCATCCCCTACGAGGGTCCAGGCGC
GGCCGCTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail