Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|223
Gene name
LocationContig_1047:653..1544
Strand-
Gene length (bp)891
Transcript length (bp)891
Coding sequence length (bp)891
Protein length (aa) 297

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup6496
Change Orthofinder run
Species Protein ID
Ophiocordyceps camponoti-floridani Ophcf2|07014
Ophiocordyceps camponoti-rufipedis Ophun1|223 (this protein)
Ophiocordyceps kimflemingae Ophio5|6689
Ophiocordyceps subramaniannii Hirsu2|106

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|223
MGHETSKINASQHATLHNYACRPMSAVASASYNVAWHEWSKSPLLVSTVYPYKEKSWTTFLSETLPSELMDDFAA
AWNVSRSRLIDRLDRNYIVNHVAFNDVMLDLYDYSRHSGPVCWPKADLESLVVGYYSSLGSLAHLVVPQHSLYGT
WSVKTFPGAPKHEFRDSETYCMSPGDSHYDDVGAAITHEMCQWTSFKTRRAERNMQDADEIFMSYSHPFIKAFAK
SFQEGYSCSAINGCLPWVFTGEAWVPPNMWRMQEKVAQLFRMRSHFCLMLGVGEPPAGFITLNTYPEARWP*
Coding >Ophun1|223
ATGGGCCACGAAACCTCAAAGATCAACGCCTCTCAGCACGCAACCCTGCACAACTACGCCTGTCGCCCCATGTCG
GCCGTAGCCTCGGCGTCCTACAACGTGGCCTGGCACGAGTGGAGCAAAAGCCCCCTTCTCGTCAGCACCGTCTAT
CCCTACAAGGAGAAGAGTTGGACGACGTTTCTGTCCGAGACGCTGCCGTCGGAGCTTATGGATGACTTTGCCGCC
GCCTGGAACGTCAGTCGCAGCAGGCTCATCGACAGACTCGATCGAAACTACATAGTCAATCACGTTGCCTTCAAC
GACGTCATGCTGGATCTATACGACTACAGTCGCCACTCCGGCCCAGTATGCTGGCCCAAAGCCGATCTCGAATCC
CTCGTAGTTGGCTATTACTCCTCGCTGGGCTCGCTGGCACATCTAGTAGTGCCCCAACACTCCCTGTACGGCACA
TGGTCCGTCAAGACGTTCCCCGGCGCCCCCAAACACGAGTTCCGCGACAGCGAGACATACTGCATGTCCCCGGGA
GACTCCCACTACGACGACGTCGGCGCCGCCATCACGCACGAGATGTGCCAGTGGACCTCGTTCAAGACGCGGCGA
GCAGAAAGAAACATGCAAGACGCCGACGAAATTTTCATGTCCTACAGCCACCCCTTCATCAAGGCGTTTGCCAAG
AGCTTCCAGGAGGGCTACTCGTGCTCGGCGATCAACGGCTGTCTGCCATGGGTGTTTACGGGCGAGGCCTGGGTT
CCGCCCAACATGTGGAGGATGCAGGAAAAGGTGGCCCAGTTGTTCAGGATGCGATCTCATTTCTGCCTCATGTTG
GGGGTGGGTGAGCCGCCTGCGGGGTTTATTACGTTGAATACGTATCCGGAGGCGAGGTGGCCGTAG
Transcript >Ophun1|223
ATGGGCCACGAAACCTCAAAGATCAACGCCTCTCAGCACGCAACCCTGCACAACTACGCCTGTCGCCCCATGTCG
GCCGTAGCCTCGGCGTCCTACAACGTGGCCTGGCACGAGTGGAGCAAAAGCCCCCTTCTCGTCAGCACCGTCTAT
CCCTACAAGGAGAAGAGTTGGACGACGTTTCTGTCCGAGACGCTGCCGTCGGAGCTTATGGATGACTTTGCCGCC
GCCTGGAACGTCAGTCGCAGCAGGCTCATCGACAGACTCGATCGAAACTACATAGTCAATCACGTTGCCTTCAAC
GACGTCATGCTGGATCTATACGACTACAGTCGCCACTCCGGCCCAGTATGCTGGCCCAAAGCCGATCTCGAATCC
CTCGTAGTTGGCTATTACTCCTCGCTGGGCTCGCTGGCACATCTAGTAGTGCCCCAACACTCCCTGTACGGCACA
TGGTCCGTCAAGACGTTCCCCGGCGCCCCCAAACACGAGTTCCGCGACAGCGAGACATACTGCATGTCCCCGGGA
GACTCCCACTACGACGACGTCGGCGCCGCCATCACGCACGAGATGTGCCAGTGGACCTCGTTCAAGACGCGGCGA
GCAGAAAGAAACATGCAAGACGCCGACGAAATTTTCATGTCCTACAGCCACCCCTTCATCAAGGCGTTTGCCAAG
AGCTTCCAGGAGGGCTACTCGTGCTCGGCGATCAACGGCTGTCTGCCATGGGTGTTTACGGGCGAGGCCTGGGTT
CCGCCCAACATGTGGAGGATGCAGGAAAAGGTGGCCCAGTTGTTCAGGATGCGATCTCATTTCTGCCTCATGTTG
GGGGTGGGTGAGCCGCCTGCGGGGTTTATTACGTTGAATACGTATCCGGAGGCGAGGTGGCCGTAG
Gene >Ophun1|223
ATGGGCCACGAAACCTCAAAGATCAACGCCTCTCAGCACGCAACCCTGCACAACTACGCCTGTCGCCCCATGTCG
GCCGTAGCCTCGGCGTCCTACAACGTGGCCTGGCACGAGTGGAGCAAAAGCCCCCTTCTCGTCAGCACCGTCTAT
CCCTACAAGGAGAAGAGTTGGACGACGTTTCTGTCCGAGACGCTGCCGTCGGAGCTTATGGATGACTTTGCCGCC
GCCTGGAACGTCAGTCGCAGCAGGCTCATCGACAGACTCGATCGAAACTACATAGTCAATCACGTTGCCTTCAAC
GACGTCATGCTGGATCTATACGACTACAGTCGCCACTCCGGCCCAGTATGCTGGCCCAAAGCCGATCTCGAATCC
CTCGTAGTTGGCTATTACTCCTCGCTGGGCTCGCTGGCACATCTAGTAGTGCCCCAACACTCCCTGTACGGCACA
TGGTCCGTCAAGACGTTCCCCGGCGCCCCCAAACACGAGTTCCGCGACAGCGAGACATACTGCATGTCCCCGGGA
GACTCCCACTACGACGACGTCGGCGCCGCCATCACGCACGAGATGTGCCAGTGGACCTCGTTCAAGACGCGGCGA
GCAGAAAGAAACATGCAAGACGCCGACGAAATTTTCATGTCCTACAGCCACCCCTTCATCAAGGCGTTTGCCAAG
AGCTTCCAGGAGGGCTACTCGTGCTCGGCGATCAACGGCTGTCTGCCATGGGTGTTTACGGGCGAGGCCTGGGTT
CCGCCCAACATGTGGAGGATGCAGGAAAAGGTGGCCCAGTTGTTCAGGATGCGATCTCATTTCTGCCTCATGTTG
GGGGTGGGTGAGCCGCCTGCGGGGTTTATTACGTTGAATACGTATCCGGAGGCGAGGTGGCCGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail