Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2225
Gene name
LocationContig_206:8614..9469
Strand+
Gene length (bp)855
Transcript length (bp)855
Coding sequence length (bp)855
Protein length (aa) 285

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13883 Pyrid_oxidase_2 Pyridoxamine 5'-phosphate oxidase 2.4E-36 34 254

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 16 0.998357

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1871
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5844
Ophiocordyceps australis map64 (Brazil) OphauB2|7418
Ophiocordyceps camponoti-floridani Ophcf2|06197
Ophiocordyceps camponoti-rufipedis Ophun1|2225 (this protein)
Ophiocordyceps kimflemingae Ophio5|3369
Ophiocordyceps subramaniannii Hirsu2|191

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2225
MKSLVVAVALSGLASGLRPPQLVFENAPRAAGIPTSRQSAVMGRRILGLSKLATFSTVFPRPGPDELEIYDESES
STGRPDDLAGVPVGLVDYVADCEDQGNPTVLAVNIGTSFRNVKAGSKLTISMSWTPPYPPAKRLPFLSRISAYMP
FLSRPRYNMPPEGARLPDTVPYSAANLPRFSLFGYLEQVGPSRSKRMELASCYVERHQDAKIWLPGTESPHQTEW
NRFVVTAVYWVGGFGDRAYIGWIPVDEWRNVTRDEWESIRLPGEHKDWDEHQRWDQGDL*
Coding >Ophun1|2225
ATGAAATCTCTCGTCGTTGCCGTGGCCCTTTCCGGGCTCGCCTCTGGCTTGCGCCCGCCTCAGTTGGTTTTCGAG
AACGCTCCTCGGGCCGCTGGCATCCCGACCAGTCGCCAGTCTGCGGTTATGGGCCGCCGAATCCTGGGGCTATCC
AAGCTCGCCACCTTTTCCACCGTCTTTCCCCGTCCCGGGCCCGACGAGCTCGAAATCTATGACGAATCAGAGTCG
TCGACCGGACGGCCCGATGATCTGGCCGGCGTCCCCGTGGGGCTCGTCGACTACGTTGCCGACTGCGAAGACCAG
GGGAATCCTACGGTGCTGGCCGTCAATATCGGCACCAGCTTCCGCAACGTCAAGGCCGGCTCCAAACTCACAATC
TCGATGAGCTGGACGCCTCCGTATCCCCCGGCCAAGAGACTTCCTTTCCTCTCCCGCATCTCGGCCTACATGCCG
TTTCTCTCTCGTCCCCGCTACAACATGCCCCCAGAGGGCGCGCGCCTCCCGGACACTGTGCCCTACTCGGCCGCC
AACCTGCCGCGCTTCTCCCTCTTTGGCTACCTCGAACAGGTCGGTCCTTCGAGGTCCAAGAGGATGGAGCTGGCC
AGCTGCTACGTCGAGAGGCACCAGGACGCCAAGATCTGGCTTCCCGGCACCGAGTCCCCGCACCAGACGGAGTGG
AACAGGTTTGTTGTGACGGCCGTTTACTGGGTTGGGGGCTTCGGAGACAGGGCCTACATCGGCTGGATCCCCGTC
GACGAGTGGCGAAACGTGACGAGGGACGAGTGGGAGTCTATCCGGCTCCCTGGCGAGCACAAGGACTGGGACGAG
CATCAGCGTTGGGACCAGGGCGACCTGTGA
Transcript >Ophun1|2225
ATGAAATCTCTCGTCGTTGCCGTGGCCCTTTCCGGGCTCGCCTCTGGCTTGCGCCCGCCTCAGTTGGTTTTCGAG
AACGCTCCTCGGGCCGCTGGCATCCCGACCAGTCGCCAGTCTGCGGTTATGGGCCGCCGAATCCTGGGGCTATCC
AAGCTCGCCACCTTTTCCACCGTCTTTCCCCGTCCCGGGCCCGACGAGCTCGAAATCTATGACGAATCAGAGTCG
TCGACCGGACGGCCCGATGATCTGGCCGGCGTCCCCGTGGGGCTCGTCGACTACGTTGCCGACTGCGAAGACCAG
GGGAATCCTACGGTGCTGGCCGTCAATATCGGCACCAGCTTCCGCAACGTCAAGGCCGGCTCCAAACTCACAATC
TCGATGAGCTGGACGCCTCCGTATCCCCCGGCCAAGAGACTTCCTTTCCTCTCCCGCATCTCGGCCTACATGCCG
TTTCTCTCTCGTCCCCGCTACAACATGCCCCCAGAGGGCGCGCGCCTCCCGGACACTGTGCCCTACTCGGCCGCC
AACCTGCCGCGCTTCTCCCTCTTTGGCTACCTCGAACAGGTCGGTCCTTCGAGGTCCAAGAGGATGGAGCTGGCC
AGCTGCTACGTCGAGAGGCACCAGGACGCCAAGATCTGGCTTCCCGGCACCGAGTCCCCGCACCAGACGGAGTGG
AACAGGTTTGTTGTGACGGCCGTTTACTGGGTTGGGGGCTTCGGAGACAGGGCCTACATCGGCTGGATCCCCGTC
GACGAGTGGCGAAACGTGACGAGGGACGAGTGGGAGTCTATCCGGCTCCCTGGCGAGCACAAGGACTGGGACGAG
CATCAGCGTTGGGACCAGGGCGACCTGTGA
Gene >Ophun1|2225
ATGAAATCTCTCGTCGTTGCCGTGGCCCTTTCCGGGCTCGCCTCTGGCTTGCGCCCGCCTCAGTTGGTTTTCGAG
AACGCTCCTCGGGCCGCTGGCATCCCGACCAGTCGCCAGTCTGCGGTTATGGGCCGCCGAATCCTGGGGCTATCC
AAGCTCGCCACCTTTTCCACCGTCTTTCCCCGTCCCGGGCCCGACGAGCTCGAAATCTATGACGAATCAGAGTCG
TCGACCGGACGGCCCGATGATCTGGCCGGCGTCCCCGTGGGGCTCGTCGACTACGTTGCCGACTGCGAAGACCAG
GGGAATCCTACGGTGCTGGCCGTCAATATCGGCACCAGCTTCCGCAACGTCAAGGCCGGCTCCAAACTCACAATC
TCGATGAGCTGGACGCCTCCGTATCCCCCGGCCAAGAGACTTCCTTTCCTCTCCCGCATCTCGGCCTACATGCCG
TTTCTCTCTCGTCCCCGCTACAACATGCCCCCAGAGGGCGCGCGCCTCCCGGACACTGTGCCCTACTCGGCCGCC
AACCTGCCGCGCTTCTCCCTCTTTGGCTACCTCGAACAGGTCGGTCCTTCGAGGTCCAAGAGGATGGAGCTGGCC
AGCTGCTACGTCGAGAGGCACCAGGACGCCAAGATCTGGCTTCCCGGCACCGAGTCCCCGCACCAGACGGAGTGG
AACAGGTTTGTTGTGACGGCCGTTTACTGGGTTGGGGGCTTCGGAGACAGGGCCTACATCGGCTGGATCCCCGTC
GACGAGTGGCGAAACGTGACGAGGGACGAGTGGGAGTCTATCCGGCTCCCTGGCGAGCACAAGGACTGGGACGAG
CATCAGCGTTGGGACCAGGGCGACCTGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail