Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2222
Gene name
LocationContig_2055:21..699
Strand+
Gene length (bp)678
Transcript length (bp)450
Coding sequence length (bp)450
Protein length (aa) 150

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11785 Aft1_OSA Aft1 osmotic stress response (OSM) domain 1.4E-22 45 104

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1718
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3602
Ophiocordyceps australis map64 (Brazil) OphauB2|5275
Ophiocordyceps camponoti-floridani Ophcf2|02089
Ophiocordyceps camponoti-rufipedis Ophun1|2222 (this protein)
Ophiocordyceps kimflemingae Ophio5|4599
Ophiocordyceps subramaniannii Hirsu2|1546

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2222
MGTSPTAASARGKSASPKPSNNKPARQDPPSDVKTEPVGKLEGSSNAEVAKPLAPPPRPGQPQQAPGGNNTPDFF
APQVGGGSLSLEPNPFEQSFGGGGGPETPGGTKLPSVAALTSPSSLLPGSNATPFNWVTRIICEAASLPQTNLL*
Coding >Ophun1|2222
ATGGGGACGTCTCCCACGGCCGCCTCCGCTCGAGGCAAGTCTGCGTCTCCCAAGCCTTCGAACAATAAGCCCGCG
CGACAAGATCCACCTTCAGACGTCAAGACCGAACCTGTGGGCAAGCTCGAGGGCTCGTCCAATGCCGAAGTCGCT
AAGCCGCTTGCGCCGCCGCCACGACCCGGTCAACCTCAGCAGGCGCCGGGAGGAAACAATACGCCAGACTTCTTC
GCGCCTCAAGTCGGAGGAGGATCTCTCAGTCTGGAGCCCAATCCATTCGAACAGTCTTTTGGGGGCGGAGGAGGT
CCCGAAACTCCAGGAGGCACCAAGCTCCCCTCTGTGGCCGCGTTAACTTCGCCTTCGTCGCTGCTGCCGGGAAGC
AACGCGACTCCCTTTAATTGGGTGACGCGCATCATCTGCGAGGCGGCTTCCCTACCCCAAACGAATCTTCTTTAA
Transcript >Ophun1|2222
ATGGGGACGTCTCCCACGGCCGCCTCCGCTCGAGGCAAGTCTGCGTCTCCCAAGCCTTCGAACAATAAGCCCGCG
CGACAAGATCCACCTTCAGACGTCAAGACCGAACCTGTGGGCAAGCTCGAGGGCTCGTCCAATGCCGAAGTCGCT
AAGCCGCTTGCGCCGCCGCCACGACCCGGTCAACCTCAGCAGGCGCCGGGAGGAAACAATACGCCAGACTTCTTC
GCGCCTCAAGTCGGAGGAGGATCTCTCAGTCTGGAGCCCAATCCATTCGAACAGTCTTTTGGGGGCGGAGGAGGT
CCCGAAACTCCAGGAGGCACCAAGCTCCCCTCTGTGGCCGCGTTAACTTCGCCTTCGTCGCTGCTGCCGGGAAGC
AACGCGACTCCCTTTAATTGGGTGACGCGCATCATCTGCGAGGCGGCTTCCCTACCCCAAACGAATCTTCTTTAA
Gene >Ophun1|2222
ATGGGGACGTCTCCCACGGCCGCCTCCGCTCGAGGCAAGTCTGCGTCTCCCAAGCCTTCGAACAATAAGCCCGCG
CGACAAGGTGAGCCTCATTGTCCCCCCAAAATCACCCCCACCTATCAGCGCCTAGTCGCCACCGTCCCGTCAATC
ATCAAATCCTATCGCACCCCCATCGTCATCATCCTGTCACGCGCTCCGCTGCGGCTCCTGAGTTTCTGGTGTTTC
TCACCGCTTGCATAGATCCACCTTCAGACGTCAAGACCGAACCTGTGGGCAAGCTCGAGGGCTCGTCCAATGCCG
AAGTCGCTAAGCCGCTTGCGCCGCCGCCACGACCCGGTCAACCTCAGCAGGCGCCGGGAGGAAACAATACGCCAG
ACTTCTTCGCGCCTCAAGTCGGAGGAGGATCTCTCAGTCTGGAGCCCAATCCATTCGAACAGTCTTTTGGGGGCG
GAGGAGGTCCCGAAACTCCAGGAGGCACCAAGCTCCCCTCTGTGGCCGCGTTAACTTCGCCTTCGTCGCTGCTGC
CGGGAAGCAACGCGACTCCCTTTAATTGGGGTGGAGGCTCTCTTCGTACAGGCCCGCTGAGTCCTGCCATGCTTT
CGGGTCCGGCAAACGATTACTTCAGTGACGCGCATCATCTGCGAGGCGGCTTCCCTACCCCAAACGAATCTTCTT
TAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail