Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2214
Gene name
LocationContig_205:12261..16479
Strand-
Gene length (bp)4218
Transcript length (bp)4164
Coding sequence length (bp)4164
Protein length (aa) 1388

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14664 RICTOR_N Rapamycin-insensitive companion of mTOR, N-term 1.3E-132 230 606
PF14666 RICTOR_M Rapamycin-insensitive companion of mTOR, middle domain 8.5E-36 824 924
PF14663 RasGEF_N_2 Rapamycin-insensitive companion of mTOR RasGEF_N domain 1.5E-34 941 1043
PF14668 RICTOR_V Rapamycin-insensitive companion of mTOR, domain 5 6.2E-29 1117 1186
PF02185 HR1 Hr1 repeat 1.1E-16 105 169

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q09743|STE16_SCHPO Protein ste16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ste16 PE=3 SV=1 230 1327 0.0E+00
sp|P40061|TSC11_YEAST Target of rapamycin complex 2 subunit TSC11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TSC11 PE=1 SV=1 206 1214 1.0E-114
sp|O77203|PIAA_DICDI Protein pianissimo A OS=Dictyostelium discoideum GN=piaA PE=1 SV=1 216 1327 9.0E-113
sp|Q6R327|RICTR_HUMAN Rapamycin-insensitive companion of mTOR OS=Homo sapiens GN=RICTOR PE=1 SV=1 259 1187 2.0E-105
sp|Q6QI06|RICTR_MOUSE Rapamycin-insensitive companion of mTOR OS=Mus musculus GN=Rictor PE=1 SV=2 259 1187 2.0E-104

GO

GO Term Description Terminal node
GO:0007165 signal transduction Yes
GO:0050789 regulation of biological process No
GO:0065007 biological regulation No
GO:0009987 cellular process No
GO:0050794 regulation of cellular process No
GO:0008150 biological_process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5630
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4502
Ophiocordyceps australis map64 (Brazil) OphauB2|3362
Ophiocordyceps camponoti-floridani Ophcf2|01749
Ophiocordyceps camponoti-rufipedis Ophun1|2214 (this protein)
Ophiocordyceps kimflemingae Ophio5|4949
Ophiocordyceps subramaniannii Hirsu2|7721

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2214
MPPSSSSQQQPQQPGRSSFDRDGTPALQPPNGGQARKLSASATSFAPRGSSLNPNTGLGSFSSDLRSQTMSSRAT
SRAEVGSLYPASFADKVDEDDGSAAAEQAVAALRDKLNREMKIKEGSENMLEALNIKKAKQTKEQRQRVEAELSA
SNSRIKELRQKISDAQRPRAVPPTTPTRNLQSNGLLRSPPSISRSAMGSDIDEMLESPTLLLAELLQALEVEAMP
PEYYVSRANQLVELFKRHPAIKYDLVWSIFGLRMQMMLLSDSREVVAAGYRATRYAMTDAASLKKIRGLNVDYLV
IRSLNNYRKADVEREQALKFVRAFLDVKHGVRELSRAVVRTIVAVAEQSEDRRPGVQVADHNIDRLRPICIETLA
EIMVQDPRLLVASGGLGPLCDALAEGTYKAPESLISAFLYLLDTPCRRGYMQAGYGVEVVFTVFTDQLAGAESIL
KQNSRAIAVAMKSWSGLMALCMYDFRPIRSLIASILFPNPAVRETVLDLFFSLLRIKPPAWATSFLAGRRLTTYG
RVANMKSTSGRERSGTLSHDEDTGEQNFVDHYTALLLAVFIRAGLLQSLLRIAQSEEDATLKRKTTLLIGEVLKL
ASRLLPPSWSAELQLLPELFAAAAQFGDEAHFVASGIVYQISSVSRTLYRSAPSESIGGGLSSSDSMQNLMMAEE
HPKASTAVVFDDATFRQLLIETGVLNSSNYLKWNWDVIVKVIDGPLQMGKRLEEAIKASKFMKRIMSFYRPFKYK
FADIRSSRNTHKYVKAGCALVHSLLQSPEGIRVLADSKLLRQIAECLAQCDPVGLSSGRVEQLTDVGFGGQTSGL
TAQFPMFAKDRLTDTLCGGYFPMLGVLSSDANGLLLLERWRMFNMMYHIIDLKHRPDLIKLLLSNFDYSLQGHPR
VLLSKALVAGTKEIRIHATNTLRKCTMRPVSSLGGSGSDSRWAIQLLVTQLYDPEIEVCSTAVKILENACNRKTF
LEYIVECRPALDHLGEIGAPLLLRFLSTSIGYHYLDGLDYISNEMDDWFLGRNDSYVDVIEASLARAFLASSDDH
SHRGSMFGESEAETDYHDSHVPPHFYRELTRTREGCKLLSDKGHFDEFAATIRDHGMQTEDGELMTKVKGCLWAV
GNVGSMELGAPFLESSDVVERIIRVAESHEVMSLRGTAFFVLGLISRSTHGLEILSEHGWEANTTAMGASLGFCI
PNELSKLLSLKPWKHVKAASITLLDTQRTAREQPKVRHARPPLAPSEMPPALGEADVNERIMDLIVDLGNMVLYK
KALTDLQRLKQRKPKAFRSVDFFKNVMGLMEWNHYRLGVRRLVIDLFDKSVMRQVVFGKAASDVTAGGGVTTRGE
EGEDSSEGDDRTERQRSISEPADMPLDMVPAPLQVRR*
Coding >Ophun1|2214
ATGCCCCCCTCATCAAGTTCTCAACAGCAGCCGCAGCAGCCTGGCCGCTCCAGCTTCGACCGCGATGGCACTCCG
GCTCTGCAGCCTCCCAACGGCGGTCAAGCTCGCAAGCTATCAGCCTCGGCCACGTCCTTCGCGCCCCGCGGCAGC
AGCCTCAATCCCAACACGGGCCTCGGAAGCTTCAGCTCCGACCTGCGCAGCCAGACAATGTCCAGTCGTGCCACC
AGTCGTGCCGAGGTCGGCTCCTTGTATCCTGCTAGCTTCGCGGACAAGGTCGACGAGGACGATGGCTCCGCTGCC
GCTGAACAGGCTGTCGCCGCTCTCCGCGACAAGCTCAACCGCGAGATGAAGATCAAGGAGGGCAGCGAGAATATG
CTCGAGGCGCTTAACATCAAAAAGGCCAAGCAGACCAAGGAGCAGCGTCAGAGGGTCGAGGCCGAGCTCAGCGCC
AGCAACTCGAGGATCAAGGAGCTCCGTCAGAAGATATCCGATGCCCAGCGTCCGAGGGCTGTTCCTCCCACGACG
CCCACCAGGAACCTGCAGTCCAACGGTCTGCTCCGCTCGCCGCCGAGCATCTCTCGATCCGCCATGGGTTCCGAT
ATTGACGAGATGCTAGAGAGCCCGACTCTGCTGCTGGCCGAGCTGCTGCAGGCGCTCGAGGTCGAGGCAATGCCG
CCAGAGTACTACGTCAGCCGCGCCAACCAACTGGTCGAGCTATTCAAGCGCCATCCGGCCATCAAGTACGATCTG
GTATGGTCCATATTCGGTCTGCGCATGCAGATGATGCTATTGAGCGATAGCCGCGAAGTCGTCGCCGCCGGTTAC
CGGGCCACCAGATACGCAATGACGGACGCGGCCTCGCTCAAGAAGATTCGCGGCCTCAACGTCGACTACCTGGTC
ATCAGATCTCTCAACAACTACCGCAAGGCCGATGTCGAGCGCGAGCAAGCCCTCAAGTTCGTCCGCGCCTTTCTC
GACGTCAAGCACGGCGTCAGGGAGCTCTCCCGCGCCGTGGTCCGAACCATTGTCGCCGTGGCCGAGCAGAGCGAA
GATCGACGACCTGGCGTACAGGTGGCCGACCACAACATCGACCGGCTACGGCCCATCTGCATCGAGACGCTCGCC
GAGATCATGGTCCAGGACCCGCGGCTGCTCGTCGCGTCCGGGGGGCTCGGTCCGCTCTGCGATGCCCTGGCCGAG
GGCACCTACAAGGCCCCGGAGAGCCTGATATCCGCCTTTCTCTACCTGCTCGACACGCCCTGTCGCCGTGGCTAC
ATGCAGGCCGGCTATGGCGTGGAGGTTGTCTTTACTGTCTTTACTGATCAGCTGGCCGGCGCCGAGAGCATCCTC
AAGCAGAACTCGCGGGCCATCGCCGTCGCCATGAAGTCGTGGTCGGGTCTCATGGCCCTCTGCATGTACGACTTT
CGGCCGATACGGTCACTCATTGCGAGCATCCTGTTCCCCAACCCAGCAGTCCGCGAGACGGTTCTGGACCTGTTC
TTCTCTCTGCTACGAATCAAGCCGCCCGCGTGGGCGACTTCGTTCCTGGCGGGACGGAGGCTGACGACGTACGGA
CGTGTGGCCAACATGAAGTCGACGAGCGGCAGGGAGCGCAGCGGCACGCTCTCGCACGACGAGGACACGGGCGAG
CAGAACTTTGTCGATCACTACACGGCGCTGCTGCTGGCCGTCTTTATCAGAGCCGGCCTGCTGCAGAGCCTGCTG
CGGATCGCGCAGTCGGAGGAGGACGCGACGCTGAAGCGCAAGACGACGCTGCTGATCGGCGAGGTGCTGAAGCTG
GCCAGCCGACTGCTGCCCCCCTCGTGGAGCGCCGAGCTTCAGCTGCTGCCGGAGCTGTTCGCGGCGGCGGCTCAG
TTCGGGGACGAGGCGCACTTTGTCGCGTCGGGCATCGTCTACCAGATCAGCAGCGTCAGCAGGACCCTATACCGA
AGCGCCCCGTCCGAGTCCATCGGCGGCGGACTCTCGTCGAGCGACAGCATGCAGAACCTGATGATGGCCGAGGAG
CATCCCAAGGCCAGCACGGCCGTCGTGTTCGACGACGCCACGTTCCGCCAGCTCCTCATCGAGACGGGCGTGCTC
AACAGCTCCAACTACCTCAAATGGAACTGGGACGTCATCGTCAAGGTCATCGACGGGCCCTTGCAGATGGGGAAG
CGGCTGGAAGAGGCCATCAAGGCGTCCAAGTTCATGAAGCGCATCATGAGCTTCTACCGGCCCTTCAAGTACAAG
TTTGCCGACATCAGGAGCTCGCGCAACACGCACAAGTACGTCAAGGCCGGCTGTGCCCTGGTACACTCCCTGCTG
CAGTCGCCCGAGGGCATCAGGGTGCTGGCGGACAGCAAGCTGCTGAGGCAGATTGCCGAGTGTCTGGCGCAGTGC
GATCCGGTAGGTCTCTCGAGCGGACGGGTAGAGCAGCTTACTGACGTTGGCTTCGGGGGGCAGACGAGCGGGCTC
ACGGCTCAGTTCCCCATGTTCGCCAAGGACCGGCTCACTGACACGCTCTGTGGAGGATACTTTCCCATGCTCGGC
GTCCTCAGCAGCGATGCCAACGGGCTTCTGCTGCTGGAGAGGTGGAGGATGTTCAACATGATGTATCACATCATC
GACCTGAAGCATCGACCGGACCTTATCAAGCTCCTCCTGTCCAACTTTGACTACAGCCTTCAGGGACACCCGCGC
GTCCTGCTGTCCAAGGCGCTGGTGGCGGGCACCAAGGAGATACGGATCCATGCGACCAATACGCTGCGAAAGTGC
ACCATGAGGCCCGTCTCGTCGCTGGGTGGCAGTGGCAGCGACTCGAGATGGGCGATCCAGTTGCTCGTCACGCAG
CTGTACGATCCGGAGATCGAGGTGTGCTCGACGGCTGTCAAGATCCTGGAGAATGCGTGTAACCGCAAGACGTTT
CTCGAATACATCGTCGAGTGTCGGCCGGCGCTGGACCATCTGGGCGAGATTGGCGCGCCGCTGCTGCTGCGATTC
CTGTCTACGTCGATCGGATATCACTACCTGGACGGGCTGGACTACATCAGCAACGAGATGGACGACTGGTTCCTC
GGACGCAACGACTCGTACGTCGACGTCATCGAGGCCAGCCTGGCGAGAGCCTTTCTGGCGAGCTCGGACGACCAC
AGCCACCGCGGCAGCATGTTTGGCGAGAGCGAGGCCGAGACGGACTATCACGACAGCCACGTGCCCCCTCATTTC
TACCGGGAGTTGACGCGGACGCGCGAGGGCTGCAAGCTGTTGAGCGACAAGGGCCACTTTGACGAGTTTGCAGCG
ACGATCCGCGATCACGGGATGCAGACGGAGGACGGCGAGCTGATGACAAAGGTCAAGGGATGCCTCTGGGCCGTG
GGCAACGTCGGGTCGATGGAGCTGGGCGCGCCCTTTCTCGAGTCGAGCGACGTGGTGGAGCGCATCATCCGCGTG
GCCGAGTCTCACGAGGTCATGAGCCTGCGCGGCACCGCCTTTTTCGTCCTGGGCCTCATCTCGCGGTCGACGCAC
GGGCTGGAGATCTTGTCGGAGCACGGCTGGGAGGCCAATACGACGGCCATGGGGGCCTCGCTCGGCTTCTGCATC
CCCAACGAGCTGTCGAAGCTGCTCTCTCTGAAGCCGTGGAAGCACGTCAAGGCGGCGTCCATCACGCTGCTCGAC
ACTCAGCGGACGGCGCGGGAGCAGCCCAAGGTGCGACACGCGCGCCCACCGCTGGCGCCGTCGGAGATGCCGCCG
GCGCTGGGCGAGGCCGACGTCAACGAGCGCATCATGGATCTCATCGTCGACCTGGGCAACATGGTGCTGTACAAG
AAGGCCTTGACGGATCTGCAGCGGCTGAAGCAGCGCAAGCCCAAGGCCTTTCGCAGCGTCGACTTCTTCAAGAAT
GTCATGGGCCTGATGGAGTGGAACCACTACCGGCTCGGGGTGCGACGGCTGGTGATTGACCTGTTTGACAAGAGC
GTGATGCGACAGGTCGTCTTTGGCAAGGCCGCGAGCGACGTGACGGCCGGTGGAGGCGTGACGACGAGGGGCGAA
GAGGGCGAGGATAGCAGCGAGGGGGACGATCGGACGGAGAGGCAGAGGAGTATCAGCGAGCCGGCGGATATGCCA
TTGGACATGGTGCCTGCGCCGCTGCAGGTGCGAAGATAG
Transcript >Ophun1|2214
ATGCCCCCCTCATCAAGTTCTCAACAGCAGCCGCAGCAGCCTGGCCGCTCCAGCTTCGACCGCGATGGCACTCCG
GCTCTGCAGCCTCCCAACGGCGGTCAAGCTCGCAAGCTATCAGCCTCGGCCACGTCCTTCGCGCCCCGCGGCAGC
AGCCTCAATCCCAACACGGGCCTCGGAAGCTTCAGCTCCGACCTGCGCAGCCAGACAATGTCCAGTCGTGCCACC
AGTCGTGCCGAGGTCGGCTCCTTGTATCCTGCTAGCTTCGCGGACAAGGTCGACGAGGACGATGGCTCCGCTGCC
GCTGAACAGGCTGTCGCCGCTCTCCGCGACAAGCTCAACCGCGAGATGAAGATCAAGGAGGGCAGCGAGAATATG
CTCGAGGCGCTTAACATCAAAAAGGCCAAGCAGACCAAGGAGCAGCGTCAGAGGGTCGAGGCCGAGCTCAGCGCC
AGCAACTCGAGGATCAAGGAGCTCCGTCAGAAGATATCCGATGCCCAGCGTCCGAGGGCTGTTCCTCCCACGACG
CCCACCAGGAACCTGCAGTCCAACGGTCTGCTCCGCTCGCCGCCGAGCATCTCTCGATCCGCCATGGGTTCCGAT
ATTGACGAGATGCTAGAGAGCCCGACTCTGCTGCTGGCCGAGCTGCTGCAGGCGCTCGAGGTCGAGGCAATGCCG
CCAGAGTACTACGTCAGCCGCGCCAACCAACTGGTCGAGCTATTCAAGCGCCATCCGGCCATCAAGTACGATCTG
GTATGGTCCATATTCGGTCTGCGCATGCAGATGATGCTATTGAGCGATAGCCGCGAAGTCGTCGCCGCCGGTTAC
CGGGCCACCAGATACGCAATGACGGACGCGGCCTCGCTCAAGAAGATTCGCGGCCTCAACGTCGACTACCTGGTC
ATCAGATCTCTCAACAACTACCGCAAGGCCGATGTCGAGCGCGAGCAAGCCCTCAAGTTCGTCCGCGCCTTTCTC
GACGTCAAGCACGGCGTCAGGGAGCTCTCCCGCGCCGTGGTCCGAACCATTGTCGCCGTGGCCGAGCAGAGCGAA
GATCGACGACCTGGCGTACAGGTGGCCGACCACAACATCGACCGGCTACGGCCCATCTGCATCGAGACGCTCGCC
GAGATCATGGTCCAGGACCCGCGGCTGCTCGTCGCGTCCGGGGGGCTCGGTCCGCTCTGCGATGCCCTGGCCGAG
GGCACCTACAAGGCCCCGGAGAGCCTGATATCCGCCTTTCTCTACCTGCTCGACACGCCCTGTCGCCGTGGCTAC
ATGCAGGCCGGCTATGGCGTGGAGGTTGTCTTTACTGTCTTTACTGATCAGCTGGCCGGCGCCGAGAGCATCCTC
AAGCAGAACTCGCGGGCCATCGCCGTCGCCATGAAGTCGTGGTCGGGTCTCATGGCCCTCTGCATGTACGACTTT
CGGCCGATACGGTCACTCATTGCGAGCATCCTGTTCCCCAACCCAGCAGTCCGCGAGACGGTTCTGGACCTGTTC
TTCTCTCTGCTACGAATCAAGCCGCCCGCGTGGGCGACTTCGTTCCTGGCGGGACGGAGGCTGACGACGTACGGA
CGTGTGGCCAACATGAAGTCGACGAGCGGCAGGGAGCGCAGCGGCACGCTCTCGCACGACGAGGACACGGGCGAG
CAGAACTTTGTCGATCACTACACGGCGCTGCTGCTGGCCGTCTTTATCAGAGCCGGCCTGCTGCAGAGCCTGCTG
CGGATCGCGCAGTCGGAGGAGGACGCGACGCTGAAGCGCAAGACGACGCTGCTGATCGGCGAGGTGCTGAAGCTG
GCCAGCCGACTGCTGCCCCCCTCGTGGAGCGCCGAGCTTCAGCTGCTGCCGGAGCTGTTCGCGGCGGCGGCTCAG
TTCGGGGACGAGGCGCACTTTGTCGCGTCGGGCATCGTCTACCAGATCAGCAGCGTCAGCAGGACCCTATACCGA
AGCGCCCCGTCCGAGTCCATCGGCGGCGGACTCTCGTCGAGCGACAGCATGCAGAACCTGATGATGGCCGAGGAG
CATCCCAAGGCCAGCACGGCCGTCGTGTTCGACGACGCCACGTTCCGCCAGCTCCTCATCGAGACGGGCGTGCTC
AACAGCTCCAACTACCTCAAATGGAACTGGGACGTCATCGTCAAGGTCATCGACGGGCCCTTGCAGATGGGGAAG
CGGCTGGAAGAGGCCATCAAGGCGTCCAAGTTCATGAAGCGCATCATGAGCTTCTACCGGCCCTTCAAGTACAAG
TTTGCCGACATCAGGAGCTCGCGCAACACGCACAAGTACGTCAAGGCCGGCTGTGCCCTGGTACACTCCCTGCTG
CAGTCGCCCGAGGGCATCAGGGTGCTGGCGGACAGCAAGCTGCTGAGGCAGATTGCCGAGTGTCTGGCGCAGTGC
GATCCGGTAGGTCTCTCGAGCGGACGGGTAGAGCAGCTTACTGACGTTGGCTTCGGGGGGCAGACGAGCGGGCTC
ACGGCTCAGTTCCCCATGTTCGCCAAGGACCGGCTCACTGACACGCTCTGTGGAGGATACTTTCCCATGCTCGGC
GTCCTCAGCAGCGATGCCAACGGGCTTCTGCTGCTGGAGAGGTGGAGGATGTTCAACATGATGTATCACATCATC
GACCTGAAGCATCGACCGGACCTTATCAAGCTCCTCCTGTCCAACTTTGACTACAGCCTTCAGGGACACCCGCGC
GTCCTGCTGTCCAAGGCGCTGGTGGCGGGCACCAAGGAGATACGGATCCATGCGACCAATACGCTGCGAAAGTGC
ACCATGAGGCCCGTCTCGTCGCTGGGTGGCAGTGGCAGCGACTCGAGATGGGCGATCCAGTTGCTCGTCACGCAG
CTGTACGATCCGGAGATCGAGGTGTGCTCGACGGCTGTCAAGATCCTGGAGAATGCGTGTAACCGCAAGACGTTT
CTCGAATACATCGTCGAGTGTCGGCCGGCGCTGGACCATCTGGGCGAGATTGGCGCGCCGCTGCTGCTGCGATTC
CTGTCTACGTCGATCGGATATCACTACCTGGACGGGCTGGACTACATCAGCAACGAGATGGACGACTGGTTCCTC
GGACGCAACGACTCGTACGTCGACGTCATCGAGGCCAGCCTGGCGAGAGCCTTTCTGGCGAGCTCGGACGACCAC
AGCCACCGCGGCAGCATGTTTGGCGAGAGCGAGGCCGAGACGGACTATCACGACAGCCACGTGCCCCCTCATTTC
TACCGGGAGTTGACGCGGACGCGCGAGGGCTGCAAGCTGTTGAGCGACAAGGGCCACTTTGACGAGTTTGCAGCG
ACGATCCGCGATCACGGGATGCAGACGGAGGACGGCGAGCTGATGACAAAGGTCAAGGGATGCCTCTGGGCCGTG
GGCAACGTCGGGTCGATGGAGCTGGGCGCGCCCTTTCTCGAGTCGAGCGACGTGGTGGAGCGCATCATCCGCGTG
GCCGAGTCTCACGAGGTCATGAGCCTGCGCGGCACCGCCTTTTTCGTCCTGGGCCTCATCTCGCGGTCGACGCAC
GGGCTGGAGATCTTGTCGGAGCACGGCTGGGAGGCCAATACGACGGCCATGGGGGCCTCGCTCGGCTTCTGCATC
CCCAACGAGCTGTCGAAGCTGCTCTCTCTGAAGCCGTGGAAGCACGTCAAGGCGGCGTCCATCACGCTGCTCGAC
ACTCAGCGGACGGCGCGGGAGCAGCCCAAGGTGCGACACGCGCGCCCACCGCTGGCGCCGTCGGAGATGCCGCCG
GCGCTGGGCGAGGCCGACGTCAACGAGCGCATCATGGATCTCATCGTCGACCTGGGCAACATGGTGCTGTACAAG
AAGGCCTTGACGGATCTGCAGCGGCTGAAGCAGCGCAAGCCCAAGGCCTTTCGCAGCGTCGACTTCTTCAAGAAT
GTCATGGGCCTGATGGAGTGGAACCACTACCGGCTCGGGGTGCGACGGCTGGTGATTGACCTGTTTGACAAGAGC
GTGATGCGACAGGTCGTCTTTGGCAAGGCCGCGAGCGACGTGACGGCCGGTGGAGGCGTGACGACGAGGGGCGAA
GAGGGCGAGGATAGCAGCGAGGGGGACGATCGGACGGAGAGGCAGAGGAGTATCAGCGAGCCGGCGGATATGCCA
TTGGACATGGTGCCTGCGCCGCTGCAGGTGCGAAGATAG
Gene >Ophun1|2214
ATGCCCCCCTCATCAAGTTCTCAACAGCAGCCGCAGCAGCCTGGCCGCTCCAGCTTCGACCGCGATGGCACTCCG
GCTCTGCAGCCTCCCAACGGCGGTCAAGCTCGCAAGCTATCAGCCTCGGCCACGTCCTTCGCGCCCCGCGGCAGC
AGCCTCAATCCCAACACGGGCCTCGGAAGCTTCAGCTCCGACCTGCGCAGCCAGACAATGTCCAGTCGTGCCACC
AGTCGTGCCGAGGTCGGCTCCTTGTATCCTGCTAGCTTCGCGGACAAGGTCGACGAGGACGATGGCTCCGCTGCC
GCTGAACAGGCTGTCGCCGCTCTCCGCGACAAGCTCAACCGCGAGATGAAGATCAAGGAGGGCAGCGAGAATATG
CTCGAGGCGCTTAACATCAAAAAGGCCAAGCAGACCAAGGAGCAGCGTCAGAGGGTCGAGGCCGAGCTCAGCGCC
AGCAACTCGAGGATCAAGGAGCTCCGTCAGAAGATATCCGATGCCCAGCGTCCGAGGGCTGTTCCTCCCACGACG
CCCACCAGGAACCTGCAGTCCAACGGTCTGCTCCGCTCGCCGCCGAGCATCTCTCGATCCGCCATGGGTTCCGAT
ATTGACGAGATGCTAGAGAGCCCGACTCTGCTGCTGGCCGAGCTGCTGCAGGCGCTCGAGGTCGAGGCAATGCCG
CCAGAGTACTACGTCAGCCGCGCCAACCAACTGGTCGAGCTATTCAAGCGCCATCCGGCCATCAAGTACGATCTG
GTATGGTCCATATTCGGTCTGCGCATGCAGATGATGCTATTGAGCGATAGCCGCGAAGTCGTCGCCGCCGGTTAC
CGGGCCACCAGATACGCAATGACGGACGCGGCCTCGCTCAAGAAGATTCGCGGCCTCAACGTCGACTACCTGGTC
ATCAGGTGATAGCCCTTCGATCCCATTCCTCCCAGCCAGACCACTGATGACCCTCGCAGATCTCTCAACAACTAC
CGCAAGGCCGATGTCGAGCGCGAGCAAGCCCTCAAGTTCGTCCGCGCCTTTCTCGACGTCAAGCACGGCGTCAGG
GAGCTCTCCCGCGCCGTGGTCCGAACCATTGTCGCCGTGGCCGAGCAGAGCGAAGATCGACGACCTGGCGTACAG
GTGGCCGACCACAACATCGACCGGCTACGGCCCATCTGCATCGAGACGCTCGCCGAGATCATGGTCCAGGACCCG
CGGCTGCTCGTCGCGTCCGGGGGGCTCGGTCCGCTCTGCGATGCCCTGGCCGAGGGCACCTACAAGGCCCCGGAG
AGCCTGATATCCGCCTTTCTCTACCTGCTCGACACGCCCTGTCGCCGTGGCTACATGCAGGCCGGCTATGGCGTG
GAGGTTGTCTTTACTGTCTTTACTGATCAGCTGGCCGGCGCCGAGAGCATCCTCAAGCAGAACTCGCGGGCCATC
GCCGTCGCCATGAAGTCGTGGTCGGGTCTCATGGCCCTCTGCATGTACGACTTTCGGCCGATACGGTCACTCATT
GCGAGCATCCTGTTCCCCAACCCAGCAGTCCGCGAGACGGTTCTGGACCTGTTCTTCTCTCTGCTACGAATCAAG
CCGCCCGCGTGGGCGACTTCGTTCCTGGCGGGACGGAGGCTGACGACGTACGGACGTGTGGCCAACATGAAGTCG
ACGAGCGGCAGGGAGCGCAGCGGCACGCTCTCGCACGACGAGGACACGGGCGAGCAGAACTTTGTCGATCACTAC
ACGGCGCTGCTGCTGGCCGTCTTTATCAGAGCCGGCCTGCTGCAGAGCCTGCTGCGGATCGCGCAGTCGGAGGAG
GACGCGACGCTGAAGCGCAAGACGACGCTGCTGATCGGCGAGGTGCTGAAGCTGGCCAGCCGACTGCTGCCCCCC
TCGTGGAGCGCCGAGCTTCAGCTGCTGCCGGAGCTGTTCGCGGCGGCGGCTCAGTTCGGGGACGAGGCGCACTTT
GTCGCGTCGGGCATCGTCTACCAGATCAGCAGCGTCAGCAGGACCCTATACCGAAGCGCCCCGTCCGAGTCCATC
GGCGGCGGACTCTCGTCGAGCGACAGCATGCAGAACCTGATGATGGCCGAGGAGCATCCCAAGGCCAGCACGGCC
GTCGTGTTCGACGACGCCACGTTCCGCCAGCTCCTCATCGAGACGGGCGTGCTCAACAGCTCCAACTACCTCAAA
TGGAACTGGGACGTCATCGTCAAGGTCATCGACGGGCCCTTGCAGATGGGGAAGCGGCTGGAAGAGGCCATCAAG
GCGTCCAAGTTCATGAAGCGCATCATGAGCTTCTACCGGCCCTTCAAGTACAAGTTTGCCGACATCAGGAGCTCG
CGCAACACGCACAAGTACGTCAAGGCCGGCTGTGCCCTGGTACACTCCCTGCTGCAGTCGCCCGAGGGCATCAGG
GTGCTGGCGGACAGCAAGCTGCTGAGGCAGATTGCCGAGTGTCTGGCGCAGTGCGATCCGGTAGGTCTCTCGAGC
GGACGGGTAGAGCAGCTTACTGACGTTGGCTTCGGGGGGCAGACGAGCGGGCTCACGGCTCAGTTCCCCATGTTC
GCCAAGGACCGGCTCACTGACACGCTCTGTGGAGGATACTTTCCCATGCTCGGCGTCCTCAGCAGCGATGCCAAC
GGGCTTCTGCTGCTGGAGAGGTGGAGGATGTTCAACATGATGTATCACATCATCGACCTGAAGCATCGACCGGAC
CTTATCAAGCTCCTCCTGTCCAACTTTGACTACAGCCTTCAGGGACACCCGCGCGTCCTGCTGTCCAAGGCGCTG
GTGGCGGGCACCAAGGAGATACGGATCCATGCGACCAATACGCTGCGAAAGTGCACCATGAGGCCCGTCTCGTCG
CTGGGTGGCAGTGGCAGCGACTCGAGATGGGCGATCCAGTTGCTCGTCACGCAGCTGTACGATCCGGAGATCGAG
GTGTGCTCGACGGCTGTCAAGATCCTGGAGAATGCGTGTAACCGCAAGACGTTTCTCGAATACATCGTCGAGTGT
CGGCCGGCGCTGGACCATCTGGGCGAGATTGGCGCGCCGCTGCTGCTGCGATTCCTGTCTACGTCGATCGGATAT
CACTACCTGGACGGGCTGGACTACATCAGCAACGAGATGGACGACTGGTTCCTCGGACGCAACGACTCGTACGTC
GACGTCATCGAGGCCAGCCTGGCGAGAGCCTTTCTGGCGAGCTCGGACGACCACAGCCACCGCGGCAGCATGTTT
GGCGAGAGCGAGGCCGAGACGGACTATCACGACAGCCACGTGCCCCCTCATTTCTACCGGGAGTTGACGCGGACG
CGCGAGGGCTGCAAGCTGTTGAGCGACAAGGGCCACTTTGACGAGTTTGCAGCGACGATCCGCGATCACGGGATG
CAGACGGAGGACGGCGAGCTGATGACAAAGGTCAAGGGATGCCTCTGGGCCGTGGGCAACGTCGGGTCGATGGAG
CTGGGCGCGCCCTTTCTCGAGTCGAGCGACGTGGTGGAGCGCATCATCCGCGTGGCCGAGTCTCACGAGGTCATG
AGCCTGCGCGGCACCGCCTTTTTCGTCCTGGGCCTCATCTCGCGGTCGACGCACGGGCTGGAGATCTTGTCGGAG
CACGGCTGGGAGGCCAATACGACGGCCATGGGGGCCTCGCTCGGCTTCTGCATCCCCAACGAGCTGTCGAAGCTG
CTCTCTCTGAAGCCGTGGAAGCACGTCAAGGCGGCGTCCATCACGCTGCTCGACACTCAGCGGACGGCGCGGGAG
CAGCCCAAGGTGCGACACGCGCGCCCACCGCTGGCGCCGTCGGAGATGCCGCCGGCGCTGGGCGAGGCCGACGTC
AACGAGCGCATCATGGATCTCATCGTCGACCTGGGCAACATGGTGCTGTACAAGAAGGCCTTGACGGATCTGCAG
CGGCTGAAGCAGCGCAAGCCCAAGGCCTTTCGCAGCGTCGACTTCTTCAAGAATGTCATGGGCCTGATGGAGTGG
AACCACTACCGGCTCGGGGTGCGACGGCTGGTGATTGACCTGTTTGACAAGAGCGTGATGCGACAGGTCGTCTTT
GGCAAGGCCGCGAGCGACGTGACGGCCGGTGGAGGCGTGACGACGAGGGGCGAAGAGGGCGAGGATAGCAGCGAG
GGGGACGATCGGACGGAGAGGCAGAGGAGTATCAGCGAGCCGGCGGATATGCCATTGGACATGGTGCCTGCGCCG
CTGCAGGTGCGAAGATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail