Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2203
Gene name
LocationContig_204:10300..10974
Strand-
Gene length (bp)674
Transcript length (bp)387
Coding sequence length (bp)387
Protein length (aa) 129

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02136 NTF2 Nuclear transport factor 2 (NTF2) domain 4.4E-30 12 124

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8NJ52|NTF2_DAVTA Nuclear transport factor 2 OS=Davidiella tassiana GN=NTF2 PE=1 SV=1 10 127 2.0E-48
sp|Q96VN3|NTF2_EMENI Nuclear transport factor 2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=ntf2 PE=3 SV=1 10 127 8.0E-47
sp|P87102|NTF2_NEUCR Nuclear transport factor 2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ntf2 PE=2 SV=1 8 126 4.0E-45
sp|Q9P926|NTF2_CANAX Nuclear transport factor 2 OS=Candida albicans GN=NTF2 PE=3 SV=1 13 128 4.0E-42
sp|Q10100|NTF2_SCHPO Nuclear transport factor 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ntf2 PE=3 SV=2 10 128 2.0E-41
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8NJ52|NTF2_DAVTA Nuclear transport factor 2 OS=Davidiella tassiana GN=NTF2 PE=1 SV=1 10 127 2.0E-48
sp|Q96VN3|NTF2_EMENI Nuclear transport factor 2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=ntf2 PE=3 SV=1 10 127 8.0E-47
sp|P87102|NTF2_NEUCR Nuclear transport factor 2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ntf2 PE=2 SV=1 8 126 4.0E-45
sp|Q9P926|NTF2_CANAX Nuclear transport factor 2 OS=Candida albicans GN=NTF2 PE=3 SV=1 13 128 4.0E-42
sp|Q10100|NTF2_SCHPO Nuclear transport factor 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ntf2 PE=3 SV=2 10 128 2.0E-41
sp|Q6CQX4|NTF2_KLULA Nuclear transport factor 2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=NTF2 PE=3 SV=1 10 128 6.0E-41
sp|Q6FRC6|NTF2_CANGA Nuclear transport factor 2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=NTF2 PE=3 SV=1 10 128 1.0E-40
sp|P33331|NTF2_YEAST Nuclear transport factor 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NTF2 PE=1 SV=2 10 128 2.0E-40
sp|Q75AA5|NTF2_ASHGO Nuclear transport factor 2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=NTF2 PE=3 SV=1 4 128 5.0E-40
sp|Q6BWC0|NTF2_DEBHA Nuclear transport factor 2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=NTF2 PE=3 SV=1 13 128 2.0E-37
sp|Q6CC82|NTF2_YARLI Nuclear transport factor 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=NTF2 PE=3 SV=1 10 125 1.0E-33
sp|Q9XJ54|NTF2_ORYSJ Nuclear transport factor 2 OS=Oryza sativa subsp. japonica GN=NTF2 PE=2 SV=1 12 128 4.0E-30
sp|Q9C7F5|NTF2_ARATH Nuclear transport factor 2 OS=Arabidopsis thaliana GN=NTF2 PE=1 SV=1 14 128 9.0E-30
sp|Q86HW7|NTF2_DICDI Nuclear transport factor 2 OS=Dictyostelium discoideum GN=nutf2 PE=1 SV=1 12 126 6.0E-18
sp|P61972|NTF2_RAT Nuclear transport factor 2 OS=Rattus norvegicus GN=Nutf2 PE=1 SV=1 14 126 3.0E-17
sp|P61971|NTF2_MOUSE Nuclear transport factor 2 OS=Mus musculus GN=Nutf2 PE=1 SV=1 14 126 3.0E-17
sp|P61970|NTF2_HUMAN Nuclear transport factor 2 OS=Homo sapiens GN=NUTF2 PE=1 SV=1 14 126 3.0E-17
sp|Q32KP9|NTF2_BOVIN Nuclear transport factor 2 OS=Bos taurus GN=NUTF2 PE=2 SV=1 14 126 3.0E-17
sp|Q5R8G4|NTF2_PONAB Nuclear transport factor 2 OS=Pongo abelii GN=NUTF2 PE=2 SV=1 14 126 3.0E-17
sp|O42242|NTF2_XENLA Nuclear transport factor 2 OS=Xenopus laevis GN=ntf2 PE=2 SV=1 14 126 1.0E-16
sp|Q21735|NTF2_CAEEL Probable nuclear transport factor 2 OS=Caenorhabditis elegans GN=ran-4 PE=3 SV=1 14 125 5.0E-14
sp|O94260|G3BP_SCHPO Putative G3BP-like protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nxt3 PE=1 SV=1 14 126 1.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2203
MNNSKCLTLLLEQFIEFYYNTFDTDRKSLLTLYREDSMLTFESASCRGATNIVEKLAGLHFERVKHQVSTLDAQP
SNSDGGIFIMVTGQLLVDEEQRPMNYTQAFQLARDPANGQYFVFNDVFKLVYG*
Coding >Ophun1|2203
ATGAACAATAGTAAGTGTCTGACGCTGTTGCTGGAGCAATTTATCGAGTTTTACTACAATACGTTTGACACGGAT
CGCAAGTCACTCCTCACGCTCTACCGCGAGGATTCGATGCTCACGTTCGAGTCCGCCTCGTGTCGTGGGGCTACC
AACATCGTCGAGAAGCTTGCGGGCTTACATTTTGAAAGAGTCAAGCATCAGGTTTCCACACTCGACGCGCAGCCG
TCCAACTCGGATGGCGGCATCTTCATCATGGTGACGGGCCAGCTATTGGTTGACGAAGAGCAACGCCCGATGAAC
TACACGCAGGCTTTCCAGTTGGCGCGCGACCCGGCCAACGGTCAATACTTTGTATTCAACGATGTCTTCAAGCTG
GTCTATGGTTGA
Transcript >Ophun1|2203
ATGAACAATAGTAAGTGTCTGACGCTGTTGCTGGAGCAATTTATCGAGTTTTACTACAATACGTTTGACACGGAT
CGCAAGTCACTCCTCACGCTCTACCGCGAGGATTCGATGCTCACGTTCGAGTCCGCCTCGTGTCGTGGGGCTACC
AACATCGTCGAGAAGCTTGCGGGCTTACATTTTGAAAGAGTCAAGCATCAGGTTTCCACACTCGACGCGCAGCCG
TCCAACTCGGATGGCGGCATCTTCATCATGGTGACGGGCCAGCTATTGGTTGACGAAGAGCAACGCCCGATGAAC
TACACGCAGGCTTTCCAGTTGGCGCGCGACCCGGCCAACGGTCAATACTTTGTATTCAACGATGTCTTCAAGCTG
GTCTATGGTTGA
Gene >Ophun1|2203
ATGAACAATAGTAAGTGTCTGACGCTGTTGCTGGGTGCGCGGGATGACGGCTAACCACTACCACGGAACAGACTT
TGAAGAAGTCGCTAGTAAGCATCACCACTTCTGTGTCTTGTCGGGCGCGAGGGCATCGCTGACGTGCGACAGAGC
AATTTATCGAGTTTTACTACAATACGTTTGACACGGATCGCAAGTCACTCCTCACGCTCTACGTTCGTCCGACCC
CTGATACCATCGTTGCTGGACGTCTGACTGACCTGCATGCAGCGCGAGGATTCGATGCTCACGTTCGAGTCCGCC
TCGTGTCGTGGGGCTACCAACATCGTCGAGAAGCTTGCGGTACGTCAAATCAGCCATCGCGTTCCGTTCGGGCTC
TGGCTGACTTTTCGGTTCTTGACAGGGCTTACATTTTGAAAGAGTCAAGCATCAGGTTTCCACACTCGACGCGCA
GCCGTCCAACTCGGATGGCGGCATCTTCATCATGGTGACGGGCCAGCTATTGGTATCGTCTTCTTCTGCCCGCTT
GAGAGAGGCTTGTCAGCTGATGCTCCCTCCACTAGGTTGACGAAGAGCAACGCCCGATGAACTACACGCAGGCTT
TCCAGTTGGCGCGCGACCCGGCCAACGGTCAATACTTTGTATTCAACGATGTCTTCAAGCTGGTCTATGGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail