Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|220
Gene name
LocationContig_1045:624..2314
Strand+
Gene length (bp)1690
Transcript length (bp)1575
Coding sequence length (bp)1575
Protein length (aa) 525

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 3.3E-12 69 399
PF00083 Sugar_tr Sugar (and other) transporter 2.5E-10 103 510

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9C101|YKT8_SCHPO Uncharacterized MFS-type transporter PB1E7.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPB1E7.08c PE=1 SV=1 28 524 2.0E-172
sp|Q2XWK0|SVOP_XENLA Synaptic vesicle 2-related protein OS=Xenopus laevis GN=svop PE=2 SV=1 8 521 3.0E-27
sp|Q1JP63|SVOP_BOVIN Synaptic vesicle 2-related protein OS=Bos taurus GN=SVOP PE=2 SV=1 8 521 3.0E-26
sp|Q5R5T8|SVOP_PONAB Synaptic vesicle 2-related protein OS=Pongo abelii GN=SVOP PE=2 SV=1 8 521 2.0E-25
sp|Q8BFT9|SVOP_MOUSE Synaptic vesicle 2-related protein OS=Mus musculus GN=Svop PE=1 SV=1 8 521 2.0E-25
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9C101|YKT8_SCHPO Uncharacterized MFS-type transporter PB1E7.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPB1E7.08c PE=1 SV=1 28 524 2.0E-172
sp|Q2XWK0|SVOP_XENLA Synaptic vesicle 2-related protein OS=Xenopus laevis GN=svop PE=2 SV=1 8 521 3.0E-27
sp|Q1JP63|SVOP_BOVIN Synaptic vesicle 2-related protein OS=Bos taurus GN=SVOP PE=2 SV=1 8 521 3.0E-26
sp|Q5R5T8|SVOP_PONAB Synaptic vesicle 2-related protein OS=Pongo abelii GN=SVOP PE=2 SV=1 8 521 2.0E-25
sp|Q8BFT9|SVOP_MOUSE Synaptic vesicle 2-related protein OS=Mus musculus GN=Svop PE=1 SV=1 8 521 2.0E-25
sp|Q8N4V2|SVOP_HUMAN Synaptic vesicle 2-related protein OS=Homo sapiens GN=SVOP PE=2 SV=1 8 521 2.0E-25
sp|P30638|SVOP_CAEEL Putative transporter svop-1 OS=Caenorhabditis elegans GN=svop-1 PE=3 SV=5 47 524 4.0E-25
sp|Q940M4|OCT7_ARATH Organic cation/carnitine transporter 7 OS=Arabidopsis thaliana GN=OCT7 PE=2 SV=1 51 522 5.0E-25
sp|Q9Z2I7|SVOP_RAT Synaptic vesicle 2-related protein OS=Rattus norvegicus GN=Svop PE=1 SV=1 8 521 5.0E-25
sp|Q9Y226|S22AD_HUMAN Solute carrier family 22 member 13 OS=Homo sapiens GN=SLC22A13 PE=2 SV=2 99 521 1.0E-14
sp|Q8MJI6|S22A2_RABIT Solute carrier family 22 member 2 OS=Oryctolagus cuniculus GN=SLC22A2 PE=1 SV=1 103 521 1.0E-14
sp|A7MBE0|S22A1_BOVIN Solute carrier family 22 member 1 OS=Bos taurus GN=SLC22A1 PE=2 SV=1 103 520 2.0E-14
sp|O77504|S22A1_RABIT Solute carrier family 22 member 1 OS=Oryctolagus cuniculus GN=SLC22A1 PE=1 SV=1 103 520 2.0E-14
sp|Q6A4L0|S22AD_MOUSE Solute carrier family 22 member 13 OS=Mus musculus GN=Slc22a13 PE=1 SV=3 99 521 5.0E-14
sp|O15245|S22A1_HUMAN Solute carrier family 22 member 1 OS=Homo sapiens GN=SLC22A1 PE=1 SV=2 103 520 6.0E-14
sp|Q1LVS8|SVOPL_DANRE Putative transporter SVOPL OS=Danio rerio GN=svopl PE=2 SV=1 24 524 7.0E-14
sp|Q63089|S22A1_RAT Solute carrier family 22 member 1 OS=Rattus norvegicus GN=Slc22a1 PE=1 SV=1 103 520 2.0E-13
sp|O02713|S22A2_PIG Solute carrier family 22 member 2 OS=Sus scrofa GN=SLC22A2 PE=2 SV=1 103 521 3.0E-13
sp|Q8BG39|SV2B_MOUSE Synaptic vesicle glycoprotein 2B OS=Mus musculus GN=Sv2b PE=1 SV=1 14 283 5.0E-12
sp|Q9Z0E8|S22A5_MOUSE Solute carrier family 22 member 5 OS=Mus musculus GN=Slc22a5 PE=1 SV=1 100 520 7.0E-12
sp|Q4U2R8|S22A6_HUMAN Solute carrier family 22 member 6 OS=Homo sapiens GN=SLC22A6 PE=1 SV=1 103 515 1.0E-11
sp|Q63564|SV2B_RAT Synaptic vesicle glycoprotein 2B OS=Rattus norvegicus GN=Sv2b PE=1 SV=1 14 283 2.0E-11
sp|O34691|NAIP_BACSU Putative niacin/nicotinamide transporter NaiP OS=Bacillus subtilis (strain 168) GN=naiP PE=1 SV=1 64 485 2.0E-11
sp|O08966|S22A1_MOUSE Solute carrier family 22 member 1 OS=Mus musculus GN=Slc22a1 PE=1 SV=2 103 520 2.0E-11
sp|O35956|S22A6_RAT Solute carrier family 22 member 6 OS=Rattus norvegicus GN=Slc22a6 PE=1 SV=1 106 515 4.0E-11
sp|Q5RCH6|S22A6_PONAB Solute carrier family 22 member 6 OS=Pongo abelii GN=SLC22A6 PE=2 SV=1 103 515 4.0E-11
sp|O70594|S22A5_RAT Solute carrier family 22 member 5 OS=Rattus norvegicus GN=Slc22a5 PE=1 SV=1 100 520 5.0E-11
sp|Q9WTN6|S22AL_MOUSE Solute carrier family 22 member 21 OS=Mus musculus GN=Slc22a21 PE=2 SV=1 100 520 5.0E-11
sp|Q7L1I2|SV2B_HUMAN Synaptic vesicle glycoprotein 2B OS=Homo sapiens GN=SV2B PE=1 SV=1 14 283 6.0E-11
sp|Q66J54|S226A_XENLA Solute carrier family 22 member 6-A OS=Xenopus laevis GN=slc22a6-a PE=2 SV=1 97 515 8.0E-11
sp|Q4W8A3|S22A6_MACFA Solute carrier family 22 member 6 OS=Macaca fascicularis GN=SLC22A6 PE=1 SV=1 103 515 8.0E-11
sp|Q29397|SV2A_BOVIN Synaptic vesicle glycoprotein 2A OS=Bos taurus GN=SV2A PE=2 SV=1 45 359 1.0E-10
sp|Q7ZX53|S22FL_XENLA Solute carrier family 22 member 15-like OS=Xenopus laevis GN=slc22a15b PE=2 SV=1 89 515 3.0E-10
sp|Q7L0J3|SV2A_HUMAN Synaptic vesicle glycoprotein 2A OS=Homo sapiens GN=SV2A PE=1 SV=1 45 359 3.0E-10
sp|P37514|YYAJ_BACSU Putative metabolite transport protein YyaJ OS=Bacillus subtilis (strain 168) GN=yyaJ PE=3 SV=2 105 492 3.0E-10
sp|Q4R4X3|SV2A_MACFA Synaptic vesicle glycoprotein 2A OS=Macaca fascicularis GN=SV2A PE=2 SV=1 45 359 4.0E-10
sp|Q9JIS5|SV2A_MOUSE Synaptic vesicle glycoprotein 2A OS=Mus musculus GN=Sv2a PE=1 SV=1 45 359 4.0E-10
sp|Q02563|SV2A_RAT Synaptic vesicle glycoprotein 2A OS=Rattus norvegicus GN=Sv2a PE=1 SV=2 45 359 4.0E-10
sp|Q8VC69|S22A6_MOUSE Solute carrier family 22 member 6 OS=Mus musculus GN=Slc22a6 PE=1 SV=1 106 515 6.0E-10
sp|Q8IZD6|S22AF_HUMAN Solute carrier family 22 member 15 OS=Homo sapiens GN=SLC22A15 PE=2 SV=1 232 502 7.0E-10
sp|O70577|S22A2_MOUSE Solute carrier family 22 member 2 OS=Mus musculus GN=Slc22a2 PE=1 SV=1 103 483 9.0E-10
sp|O88446|S22A3_RAT Solute carrier family 22 member 3 OS=Rattus norvegicus GN=Slc22a3 PE=2 SV=1 109 520 1.0E-09
sp|Q864Z3|S22A6_BOVIN Solute carrier family 22 member 6 OS=Bos taurus GN=SLC22A6 PE=2 SV=2 103 515 1.0E-09
sp|Q9WTW5|S22A3_MOUSE Solute carrier family 22 member 3 OS=Mus musculus GN=Slc22a3 PE=2 SV=1 109 520 2.0E-09
sp|Q5R4L9|SV2A_PONAB Synaptic vesicle glycoprotein 2A OS=Pongo abelii GN=SV2A PE=2 SV=1 45 359 2.0E-09
sp|P38055|YDJE_ECOLI Inner membrane metabolite transport protein YdjE OS=Escherichia coli (strain K12) GN=ydjE PE=1 SV=2 104 512 2.0E-09
sp|Q5R5H7|S22A2_PONAB Solute carrier family 22 member 2 OS=Pongo abelii GN=SLC22A2 PE=2 SV=1 103 497 2.0E-09
sp|Q863T6|S22A1_PIG Solute carrier family 22 member 1 OS=Sus scrofa GN=SLC22A1 PE=2 SV=1 232 520 4.0E-09
sp|Q91WU2|S22A7_MOUSE Solute carrier family 22 member 7 OS=Mus musculus GN=Slc22a7 PE=1 SV=1 110 515 4.0E-09
sp|Q66KG0|S22AG_XENLA Solute carrier family 22 member 16 OS=Xenopus laevis GN=slc22a16 PE=2 SV=2 258 515 4.0E-09
sp|Q95R48|OCTL_DROME Organic cation transporter-like protein OS=Drosophila melanogaster GN=Orct2 PE=2 SV=2 110 524 4.0E-09
sp|O15244|S22A2_HUMAN Solute carrier family 22 member 2 OS=Homo sapiens GN=SLC22A2 PE=1 SV=2 103 497 5.0E-09
sp|A6QLW8|S22A7_BOVIN Solute carrier family 22 member 7 OS=Bos taurus GN=SLC22A7 PE=2 SV=1 111 503 5.0E-09
sp|Q9R0W2|S22A2_RAT Solute carrier family 22 member 2 OS=Rattus norvegicus GN=Slc22a2 PE=1 SV=1 103 483 6.0E-09
sp|Q8MK48|S22A6_PIG Solute carrier family 22 member 6 OS=Sus scrofa GN=SLC22A6 PE=1 SV=2 99 515 6.0E-09
sp|Q3YAW7|S22A7_RABIT Solute carrier family 22 member 7 OS=Oryctolagus cuniculus GN=SLC22A7 PE=2 SV=1 110 503 6.0E-09
sp|Q504N2|S22AF_MOUSE Solute carrier family 22 member 15 OS=Mus musculus GN=Slc22a15 PE=2 SV=3 243 502 7.0E-09
sp|Q9TSY7|S22A6_RABIT Solute carrier family 22 member 6 OS=Oryctolagus cuniculus GN=SLC22A6 PE=2 SV=1 111 515 1.0E-08
sp|Q6NUB3|S22AF_XENLA Solute carrier family 22 member 15 OS=Xenopus laevis GN=slc22a15 PE=2 SV=2 256 515 2.0E-08
sp|Q496J9|SV2C_HUMAN Synaptic vesicle glycoprotein 2C OS=Homo sapiens GN=SV2C PE=1 SV=1 45 322 4.0E-08
sp|O75751|S22A3_HUMAN Solute carrier family 22 member 3 OS=Homo sapiens GN=SLC22A3 PE=1 SV=1 109 520 6.0E-08
sp|Q9VCA2|ORCT_DROME Organic cation transporter protein OS=Drosophila melanogaster GN=Orct PE=1 SV=1 110 502 7.0E-08
sp|O57379|S22A6_PSEAM Solute carrier family 22 member 6 OS=Pseudopleuronectes americanus GN=SLC22A6 PE=1 SV=1 81 515 7.0E-08
sp|Q8CFZ5|S22AC_MOUSE Solute carrier family 22 member 12 OS=Mus musculus GN=Slc22a12 PE=1 SV=1 106 515 8.0E-08
sp|Q5R540|S22A7_PONAB Solute carrier family 22 member 7 OS=Pongo abelii GN=SLC22A7 PE=2 SV=1 111 503 8.0E-08
sp|Q8TCC7|S22A8_HUMAN Solute carrier family 22 member 8 OS=Homo sapiens GN=SLC22A8 PE=1 SV=1 103 515 9.0E-08
sp|Q9Z2I6|SV2C_RAT Synaptic vesicle glycoprotein 2C OS=Rattus norvegicus GN=Sv2c PE=1 SV=1 45 440 1.0E-07
sp|O88909|S22A8_MOUSE Solute carrier family 22 member 8 OS=Mus musculus GN=Slc22a8 PE=1 SV=2 232 514 1.0E-07
sp|Q69ZS6|SV2C_MOUSE Synaptic vesicle glycoprotein 2C OS=Mus musculus GN=Sv2c PE=1 SV=2 45 440 1.0E-07
sp|Q80UJ1|S22AK_MOUSE Solute carrier family 22 member 20 OS=Mus musculus GN=Slc22a20 PE=1 SV=1 103 511 1.0E-07
sp|Q1RPP5|S22A7_PIG Solute carrier family 22 member 7 OS=Sus scrofa GN=SLC22A7 PE=2 SV=1 111 503 1.0E-07
sp|Q9Y694|S22A7_HUMAN Solute carrier family 22 member 7 OS=Homo sapiens GN=SLC22A7 PE=1 SV=1 111 503 2.0E-07
sp|Q70BM6|S22A8_PIG Solute carrier family 22 member 8 OS=Sus scrofa GN=SLC22A8 PE=2 SV=1 103 515 3.0E-07
sp|Q9SAK7|OCT5_ARATH Organic cation/carnitine transporter 5 OS=Arabidopsis thaliana GN=OCT5 PE=2 SV=1 251 486 3.0E-07
sp|Q86VW1|S22AG_HUMAN Solute carrier family 22 member 16 OS=Homo sapiens GN=SLC22A16 PE=1 SV=1 99 522 3.0E-07
sp|O76082|S22A5_HUMAN Solute carrier family 22 member 5 OS=Homo sapiens GN=SLC22A5 PE=1 SV=1 110 520 3.0E-07
sp|Q5R9C4|S22A8_PONAB Solute carrier family 22 member 8 OS=Pongo abelii GN=SLC22A8 PE=2 SV=1 103 515 4.0E-07
sp|Q7RVX9|PHO5_NEUCR Repressible high-affinity phosphate permease OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pho-5 PE=1 SV=2 41 521 4.0E-07
sp|P25297|PHO84_YEAST Inorganic phosphate transporter PHO84 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHO84 PE=1 SV=2 41 482 4.0E-07
sp|Q4W8A2|S22A8_MACFA Solute carrier family 22 member 8 OS=Macaca fascicularis GN=SLC22A8 PE=2 SV=1 103 515 5.0E-07
sp|Q9H015|S22A4_HUMAN Solute carrier family 22 member 4 OS=Homo sapiens GN=SLC22A4 PE=1 SV=3 256 520 1.0E-06
sp|Q9R141|S22A4_RAT Solute carrier family 22 member 4 OS=Rattus norvegicus GN=Slc22a4 PE=1 SV=1 256 520 1.0E-06
sp|Q9R1U7|S22A8_RAT Solute carrier family 22 member 8 OS=Rattus norvegicus GN=Slc22a8 PE=1 SV=1 103 513 1.0E-06
sp|Q43975|PCAK_ACIAD 4-hydroxybenzoate transporter PcaK OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=pcaK PE=1 SV=3 63 313 2.0E-06
sp|Q9U539|OCT1_CAEEL Organic cation transporter 1 OS=Caenorhabditis elegans GN=oct-1 PE=1 SV=3 251 515 2.0E-06
sp|Q6DFR1|S22AF_XENTR Solute carrier family 22 member 15 OS=Xenopus tropicalis GN=slc22a15 PE=2 SV=2 232 515 3.0E-06
sp|Q9Z306|S22A4_MOUSE Solute carrier family 22 member 4 OS=Mus musculus GN=Slc22a4 PE=1 SV=1 256 520 3.0E-06
sp|Q3ZAV1|S22AC_RAT Solute carrier family 22 member 12 OS=Rattus norvegicus GN=Slc22a12 PE=2 SV=1 99 304 6.0E-06
sp|Q9CAT6|OCT1_ARATH Organic cation/carnitine transporter 1 OS=Arabidopsis thaliana GN=OCT1 PE=2 SV=1 257 470 7.0E-06
sp|Q17QN9|S22AG_BOVIN Solute carrier family 22 member 16 OS=Bos taurus GN=SLC22A16 PE=2 SV=2 258 515 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0051179 localization No
GO:0005215 transporter activity No
GO:0051234 establishment of localization No
GO:0003674 molecular_function No
GO:0009987 cellular process No
GO:0005575 cellular_component No
GO:0006810 transport No
GO:0110165 cellular anatomical entity No
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 44 0.45

Transmembrane Domains

Domain # Start End Length
1 67 89 22
2 104 123 19
3 136 158 22
4 232 254 22
5 339 361 22
6 376 398 22
7 410 428 18
8 432 454 22
9 467 489 22
10 494 516 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|220
MGVENAVDEVVTSPHDPPIYTSSIELASDEDDAIIPKGAIDPVYEAKARLLNRAIREMGMGWYQWQLFVVVGFGW
ASDNLWPVVTALIFTPIAQEFHPDRPPLFTLAQNIGLLAGAAFWGFGCDVFGRKLGFNLTLGLTAFWGLVAASAP
SFAAIGFFACMWSFGVGGNLPVDSAVFLEFLPASHQYLLTVLSIDWSLAQVIANLIAWPLLTKFTCSQEQAQSCS
RRDNMGWRYFTLVMGGMTLIMFLTRFVFFTIYESPKYLVGKGRDAEAVRVLHEVARRNGTTATLTLEDLKACEPE
GYVAQTDTSAAVKRYMEKVDTQHVRALFAGRRLARSTGLIMAIWALIGLGYPLYNAFLPFIQATRGVQFQDGSNN
ITYRNSLIIAVLGVPGAILGGFLVELPRMGRKGTLSIFTLLTGVFLFCSTTAANSTALLGWNCAFNFCSNVMYAV
LYGYTPEIFPTPQRGTGNALCASCNRVFGIMAPIVAMFANLQTAAPVYGSGALFLTAGALVLFLPFESQGREAL*
Coding >Ophun1|220
ATGGGTGTCGAAAATGCTGTCGACGAGGTCGTCACCTCTCCCCACGACCCCCCCATCTACACAAGCAGCATCGAG
CTGGCCTCGGATGAGGATGATGCCATCATCCCCAAGGGCGCCATCGATCCCGTTTACGAGGCCAAGGCCCGACTG
CTCAACCGCGCCATCCGTGAGATGGGCATGGGATGGTATCAATGGCAGCTCTTCGTCGTCGTCGGCTTCGGCTGG
GCCAGCGACAATCTGTGGCCCGTCGTCACCGCCCTCATCTTTACCCCCATCGCTCAAGAATTCCATCCCGACCGG
CCACCGCTCTTCACCCTGGCCCAAAACATCGGCCTCCTCGCCGGGGCTGCTTTTTGGGGCTTCGGCTGTGACGTC
TTCGGACGCAAGCTCGGCTTCAACCTGACGCTGGGTCTCACCGCATTCTGGGGTCTCGTGGCCGCCAGCGCACCC
AGCTTCGCCGCCATTGGCTTCTTCGCCTGCATGTGGTCATTTGGAGTCGGAGGCAACCTGCCCGTCGACTCGGCC
GTCTTCCTCGAGTTCCTGCCGGCGAGCCACCAGTACCTGCTGACGGTCCTGTCCATTGACTGGTCCCTGGCCCAG
GTCATTGCCAATCTCATCGCCTGGCCGCTCCTCACCAAGTTCACGTGCTCCCAGGAACAGGCCCAGTCGTGCTCC
CGTCGCGACAACATGGGATGGCGGTACTTCACCCTGGTCATGGGCGGCATGACGCTCATCATGTTCCTCACCCGC
TTCGTCTTCTTCACCATTTACGAATCGCCCAAGTATCTGGTTGGCAAGGGCCGCGACGCCGAAGCCGTCCGTGTC
CTGCACGAGGTGGCCCGGCGCAACGGCACGACGGCGACGCTGACGCTGGAGGACCTAAAGGCCTGCGAGCCCGAA
GGCTACGTGGCCCAGACGGACACGTCGGCGGCCGTCAAGAGGTACATGGAAAAGGTGGACACTCAGCACGTCAGG
GCGCTGTTCGCGGGCCGCCGGTTGGCCAGGAGCACGGGTCTCATCATGGCCATCTGGGCCCTCATCGGCCTCGGC
TACCCCCTCTACAACGCCTTCTTGCCCTTCATCCAGGCCACTCGGGGCGTCCAGTTCCAGGACGGGAGCAACAAC
ATCACCTACCGCAACAGCCTCATCATTGCGGTTCTCGGCGTCCCGGGCGCCATCCTCGGCGGCTTCCTGGTGGAG
CTGCCACGGATGGGCCGCAAGGGCACCCTCTCCATCTTCACCCTCCTCACCGGCGTCTTTCTCTTTTGCTCGACG
ACGGCCGCCAACAGCACCGCCCTTCTCGGCTGGAACTGCGCCTTTAACTTTTGCAGCAACGTCATGTACGCCGTC
CTCTACGGCTACACGCCCGAGATCTTTCCCACGCCCCAGCGCGGCACGGGCAACGCGTTGTGCGCCTCCTGCAAC
CGCGTCTTTGGCATCATGGCTCCCATCGTTGCCATGTTTGCCAACCTGCAGACGGCGGCCCCGGTCTACGGTAGC
GGCGCGCTGTTTCTCACCGCAGGCGCCCTCGTCTTGTTCCTCCCGTTTGAGTCTCAAGGGAGAGAGGCCCTGTGA
Transcript >Ophun1|220
ATGGGTGTCGAAAATGCTGTCGACGAGGTCGTCACCTCTCCCCACGACCCCCCCATCTACACAAGCAGCATCGAG
CTGGCCTCGGATGAGGATGATGCCATCATCCCCAAGGGCGCCATCGATCCCGTTTACGAGGCCAAGGCCCGACTG
CTCAACCGCGCCATCCGTGAGATGGGCATGGGATGGTATCAATGGCAGCTCTTCGTCGTCGTCGGCTTCGGCTGG
GCCAGCGACAATCTGTGGCCCGTCGTCACCGCCCTCATCTTTACCCCCATCGCTCAAGAATTCCATCCCGACCGG
CCACCGCTCTTCACCCTGGCCCAAAACATCGGCCTCCTCGCCGGGGCTGCTTTTTGGGGCTTCGGCTGTGACGTC
TTCGGACGCAAGCTCGGCTTCAACCTGACGCTGGGTCTCACCGCATTCTGGGGTCTCGTGGCCGCCAGCGCACCC
AGCTTCGCCGCCATTGGCTTCTTCGCCTGCATGTGGTCATTTGGAGTCGGAGGCAACCTGCCCGTCGACTCGGCC
GTCTTCCTCGAGTTCCTGCCGGCGAGCCACCAGTACCTGCTGACGGTCCTGTCCATTGACTGGTCCCTGGCCCAG
GTCATTGCCAATCTCATCGCCTGGCCGCTCCTCACCAAGTTCACGTGCTCCCAGGAACAGGCCCAGTCGTGCTCC
CGTCGCGACAACATGGGATGGCGGTACTTCACCCTGGTCATGGGCGGCATGACGCTCATCATGTTCCTCACCCGC
TTCGTCTTCTTCACCATTTACGAATCGCCCAAGTATCTGGTTGGCAAGGGCCGCGACGCCGAAGCCGTCCGTGTC
CTGCACGAGGTGGCCCGGCGCAACGGCACGACGGCGACGCTGACGCTGGAGGACCTAAAGGCCTGCGAGCCCGAA
GGCTACGTGGCCCAGACGGACACGTCGGCGGCCGTCAAGAGGTACATGGAAAAGGTGGACACTCAGCACGTCAGG
GCGCTGTTCGCGGGCCGCCGGTTGGCCAGGAGCACGGGTCTCATCATGGCCATCTGGGCCCTCATCGGCCTCGGC
TACCCCCTCTACAACGCCTTCTTGCCCTTCATCCAGGCCACTCGGGGCGTCCAGTTCCAGGACGGGAGCAACAAC
ATCACCTACCGCAACAGCCTCATCATTGCGGTTCTCGGCGTCCCGGGCGCCATCCTCGGCGGCTTCCTGGTGGAG
CTGCCACGGATGGGCCGCAAGGGCACCCTCTCCATCTTCACCCTCCTCACCGGCGTCTTTCTCTTTTGCTCGACG
ACGGCCGCCAACAGCACCGCCCTTCTCGGCTGGAACTGCGCCTTTAACTTTTGCAGCAACGTCATGTACGCCGTC
CTCTACGGCTACACGCCCGAGATCTTTCCCACGCCCCAGCGCGGCACGGGCAACGCGTTGTGCGCCTCCTGCAAC
CGCGTCTTTGGCATCATGGCTCCCATCGTTGCCATGTTTGCCAACCTGCAGACGGCGGCCCCGGTCTACGGTAGC
GGCGCGCTGTTTCTCACCGCAGGCGCCCTCGTCTTGTTCCTCCCGTTTGAGTCTCAAGGGAGAGAGGCCCTGTGA
Gene >Ophun1|220
ATGGGTGTCGAAAATGCTGTCGACGAGGTCGTCACCTCTCCCCACGACCCCCCCATCTACACAAGCAGCATCGAG
CTGGCCTCGGATGAGGATGATGCCATCATCCCCAAGGGCGCCATCGATCCCGTTTACGAGGCCAAGGCCCGACTG
CTCAACCGCGCCGTGCGTCTTTTTTCCCCTTCCCCCGCTTTCATCCCGCTCCTGCTGACGGTACCCTTCAGATCC
GTGAGATGGGCATGGGATGGTATCAATGGCAGCTCTTCGTCGTCGTCGGCTTCGGCTGGGCCAGCGACAATCTGT
GGCCCGTCGTCACCGCCCTCATCTTTACCCCCATCGCTCAAGAATTCCATCCCGACCGGCCACCGCTCTTCACCC
TGGCCCAAAACATCGGCCTCCTCGCCGGGGCTGCTTTTTGGGGCTTCGGCTGTGACGTCTTCGGACGCAAGCTCG
GCTTCAACCTGACGCTGGGTCTCACCGCATTCTGGGGTCTCGTGGCCGCCAGCGCACCCAGCTTCGCCGCCATTG
GCTTCTTCGCCTGCATGTGGTCATTTGGAGTCGGAGGCAACCTGCCCGTCGACTCGGCCGTCTTCCTCGAGTTCC
TGCCGGCGAGCCACCAGTACCTGCTGACGGTCCTGTCCATTGACTGGTCCCTGGCCCAGGTCATTGCCAATCTCA
TCGCCTGGCCGCTCCTCACCAAGTTCACGTGCTCCCAGGAACAGGCCCAGTCGTGCTCCCGTCGCGACAACATGG
GATGGCGGTACTTCACCCTGGTCATGGGCGGCATGACGCTCATCATGTTCCTCACCCGCTTCGTCTTCTTCACCA
TTTACGAATCGCCCAAGTATCTGGTTGGCAAGGGCCGCGACGCCGAAGCCGTCCGTGTCCTGCACGAGGTGGCCC
GGCGCAACGGCACGACGGCGACGCTGACGCTGGAGGACCTAAAGGCCTGCGAGCCCGAAGGCTACGTGGCCCAGA
CGGACACGTCGGCGGCCGTCAAGAGGTACATGGAAAAGGTGGACACTCAGCACGTCAGGGCGCTGTTCGCGGGCC
GCCGGTTGGCCAGGAGCACGGGTCTCATCATGGCCATCTGGGCCCTCATCGGCCTCGGCTACCCCCTCTACAACG
CCTTCTTGCCCTTCATCCAGGCCACTCGGGGCGTCCAGTTCCAGGACGGGAGCAACAACATCACCTACCGCAACA
GCCTCATCATTGCGGTTCTCGGCGTCCCGGGCGCCATCCTCGGCGGCTTCCTGGTGGAGCTGCCACGGATGGGCC
GCAAGGGCACCCTCTCCATCTTCACCCTCCTCACCGGCGTCTTTCTCTTTTGCTCGACGACGGCCGCCAACAGCA
CCGCCCTTCTCGGCTGGAACTGCGCCTTTAACTTTTGCAGCAACGTCATGTACGCCGTCCTCTACGGCTACACGC
CCGAGATCTTTCCCACGCCCCAGCGCGGCACGGGCAACGCGTTGTGCGCCTCCTGCAACCGCGTCTTTGGCATCA
TGGCTGTGAGTCATCTCGGCAAGATGAGAAGAGAACAGAGAGACTGACGAGCCCCTTACAGCCCATCGTTGCCAT
GTTTGCCAACCTGCAGACGGCGGCCCCGGTCTACGGTAGCGGCGCGCTGTTTCTCACCGCAGGCGCCCTCGTCTT
GTTCCTCCCGTTTGAGTCTCAAGGGAGAGAGGCCCTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail