Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2194
Gene name
LocationContig_203:18303..20181
Strand-
Gene length (bp)1878
Transcript length (bp)1296
Coding sequence length (bp)1296
Protein length (aa) 432

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09419 PGP_phosphatase Mitochondrial PGP phosphatase 2.8E-63 5 179

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P38812|GEP4_YEAST Phosphatidylglycerophosphatase GEP4, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GEP4 PE=1 SV=1 4 179 6.0E-49
sp|Q9Y7U3|GEP4_SCHPO Probable phosphatidylglycerophosphatase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gep4 PE=3 SV=2 18 179 5.0E-25

GO

GO Term Description Terminal node
GO:0008962 phosphatidylglycerophosphatase activity Yes
GO:0003674 molecular_function No
GO:0042578 phosphoric ester hydrolase activity No
GO:0016791 phosphatase activity No
GO:0003824 catalytic activity No
GO:0016787 hydrolase activity No
GO:0016788 hydrolase activity, acting on ester bonds No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup525
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5581
Ophiocordyceps australis map64 (Brazil) OphauB2|1026
Ophiocordyceps camponoti-floridani Ophcf2|05875
Ophiocordyceps camponoti-floridani Ophcf2|06455
Ophiocordyceps camponoti-floridani Ophcf2|07447
Ophiocordyceps camponoti-rufipedis Ophun1|2194 (this protein)
Ophiocordyceps kimflemingae Ophio5|460
Ophiocordyceps subramaniannii Hirsu2|2931

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2194
MNPNVSASFNVWRLLLKPGLCLPHHTAATFNDLPIPLDAALRGNDREAIIKAVVLDKDDCFASPNANQVHEPYKQ
HFEALKRAYPGRRLLVVSNTAGAASWDSGLKQAADVERNTGVAVLAHSVKKPGCGSEIMAYFRSHPETGVTDASE
VAVVGDRLMTDVMMANMMGSWAFWIKDGVVPLTRKSFGSASSGSHRSWCKLQAACSDEQMTLAGGYSDSRESRTK
FRDRIWDKNEEEHFWNTIVPKSPVAADGKGLQMSWVALAEEMRNKFGGSRRNYTWLMLYEHWYQNARTGHSSPHG
RHLVAEYKRQIATCVKPAVIMKPVNKPATKPVNKTAARRSATAGRTRVVKRSAQRPSASCGRTRPLVGESAAVKA
DIDGGLQGPTCAPRPAPTNPGFHGSFVVHGSAVGPQAWIPGLISEGPGYGSSASVL*
Coding >Ophun1|2194
ATGAATCCAAACGTCTCGGCTTCATTCAACGTCTGGAGGCTCCTGCTGAAGCCTGGACTTTGTCTTCCTCATCAT
ACCGCTGCCACATTCAACGATCTTCCTATACCTCTGGATGCGGCCTTACGGGGAAACGACCGAGAAGCCATCATC
AAGGCCGTCGTGCTCGACAAGGACGACTGTTTCGCGTCACCCAATGCAAATCAAGTCCATGAGCCTTACAAGCAA
CACTTCGAGGCTCTCAAGCGGGCGTATCCCGGCCGCCGGCTACTCGTCGTATCCAATACCGCTGGGGCCGCCAGT
TGGGACAGCGGTCTGAAGCAGGCTGCCGACGTGGAGAGGAATACGGGCGTTGCTGTTCTCGCTCACTCGGTCAAG
AAACCCGGCTGCGGTTCAGAGATCATGGCCTACTTCCGCAGCCATCCAGAGACGGGCGTGACCGATGCCTCTGAA
GTTGCCGTCGTGGGGGACCGTCTGATGACGGATGTCATGATGGCAAACATGATGGGATCATGGGCTTTCTGGATT
AAAGATGGAGTTGTGCCCCTTACGCGGAAAAGTTTTGGGAGTGCAAGCTCCGGCTCCCACCGCTCCTGGTGCAAA
TTACAAGCCGCCTGTTCGGACGAGCAGATGACGTTGGCGGGCGGCTACAGCGACAGTCGTGAATCACGGACGAAG
TTTCGGGACCGGATCTGGGACAAGAACGAGGAGGAGCACTTCTGGAACACCATCGTTCCCAAGTCTCCCGTCGCC
GCGGATGGTAAGGGCCTGCAGATGAGCTGGGTCGCCCTGGCCGAGGAAATGAGGAATAAGTTCGGAGGAAGTCGC
CGCAATTACACGTGGCTGATGCTCTATGAGCATTGGTACCAGAACGCGCGGACCGGGCATTCGTCGCCACATGGG
CGACACCTGGTCGCAGAATACAAGAGGCAGATCGCGACCTGCGTCAAGCCGGCTGTCATCATGAAGCCGGTAAAC
AAGCCGGCCACCAAGCCGGTGAACAAGACGGCGGCTCGACGGTCCGCGACAGCTGGTCGGACCCGGGTGGTCAAA
CGGTCAGCACAGAGGCCGTCTGCCAGCTGTGGTCGAACGAGGCCGCTGGTCGGCGAGTCGGCCGCGGTGAAAGCC
GATATCGACGGCGGCCTCCAGGGGCCAACATGTGCTCCTCGCCCGGCGCCGACAAATCCGGGCTTTCACGGCAGC
TTCGTCGTCCACGGTTCAGCCGTGGGACCGCAGGCCTGGATCCCCGGGCTCATCTCAGAGGGTCCGGGCTATGGG
TCCAGTGCCTCGGTTCTGTGA
Transcript >Ophun1|2194
ATGAATCCAAACGTCTCGGCTTCATTCAACGTCTGGAGGCTCCTGCTGAAGCCTGGACTTTGTCTTCCTCATCAT
ACCGCTGCCACATTCAACGATCTTCCTATACCTCTGGATGCGGCCTTACGGGGAAACGACCGAGAAGCCATCATC
AAGGCCGTCGTGCTCGACAAGGACGACTGTTTCGCGTCACCCAATGCAAATCAAGTCCATGAGCCTTACAAGCAA
CACTTCGAGGCTCTCAAGCGGGCGTATCCCGGCCGCCGGCTACTCGTCGTATCCAATACCGCTGGGGCCGCCAGT
TGGGACAGCGGTCTGAAGCAGGCTGCCGACGTGGAGAGGAATACGGGCGTTGCTGTTCTCGCTCACTCGGTCAAG
AAACCCGGCTGCGGTTCAGAGATCATGGCCTACTTCCGCAGCCATCCAGAGACGGGCGTGACCGATGCCTCTGAA
GTTGCCGTCGTGGGGGACCGTCTGATGACGGATGTCATGATGGCAAACATGATGGGATCATGGGCTTTCTGGATT
AAAGATGGAGTTGTGCCCCTTACGCGGAAAAGTTTTGGGAGTGCAAGCTCCGGCTCCCACCGCTCCTGGTGCAAA
TTACAAGCCGCCTGTTCGGACGAGCAGATGACGTTGGCGGGCGGCTACAGCGACAGTCGTGAATCACGGACGAAG
TTTCGGGACCGGATCTGGGACAAGAACGAGGAGGAGCACTTCTGGAACACCATCGTTCCCAAGTCTCCCGTCGCC
GCGGATGGTAAGGGCCTGCAGATGAGCTGGGTCGCCCTGGCCGAGGAAATGAGGAATAAGTTCGGAGGAAGTCGC
CGCAATTACACGTGGCTGATGCTCTATGAGCATTGGTACCAGAACGCGCGGACCGGGCATTCGTCGCCACATGGG
CGACACCTGGTCGCAGAATACAAGAGGCAGATCGCGACCTGCGTCAAGCCGGCTGTCATCATGAAGCCGGTAAAC
AAGCCGGCCACCAAGCCGGTGAACAAGACGGCGGCTCGACGGTCCGCGACAGCTGGTCGGACCCGGGTGGTCAAA
CGGTCAGCACAGAGGCCGTCTGCCAGCTGTGGTCGAACGAGGCCGCTGGTCGGCGAGTCGGCCGCGGTGAAAGCC
GATATCGACGGCGGCCTCCAGGGGCCAACATGTGCTCCTCGCCCGGCGCCGACAAATCCGGGCTTTCACGGCAGC
TTCGTCGTCCACGGTTCAGCCGTGGGACCGCAGGCCTGGATCCCCGGGCTCATCTCAGAGGGTCCGGGCTATGGG
TCCAGTGCCTCGGTTCTGTGA
Gene >Ophun1|2194
ATGAATCCAAACGTCTCGGCTTCATTCAACGTCTGGAGGCTCCTGCTGAAGCCTGGACTTTGTCTTCCTCATCAT
ACCGCTGCCACATTCAACGATCTTCCTATACCTCTGGATGCGGCCTTACGGGGAAACGACCGAGAAGCCATCATC
AAGGCCGTCGTGCTCGACAAGGACGACTGTTTCGCGTCACCCAATGCAAATCAAGTCCATGAGCCTTACAAGGTG
GGCAAGTACTCGCTGGCATGGGCATAGTCACGCTCACAAGCTCGGCGCGTAGCAACACTTCGAGGCTCTCAAGCG
GGCGTATCCCGGCCGCCGGCTACTCGTCGTATCCAATACCGCTGGGGCCGCCAGTTGGGACAGCGGTCTGAAGCA
GGCTGCCGACGTGGAGAGGAATACGGGCGTTGCTGTTCTCGCTCACTCGGTCAAGAAACCCGGCTGCGGTTCAGA
GATCATGGCCTACTTCCGCAGCCATCCAGAGACGGGCGTGACCGATGCCTCTGAAGTTGCCGTCGTGGGGGACCG
TCTGATGACGGATGTCATGATGGCAAACATGATGGGATCATGGGCTTTCTGGATTAAAGATGGAGTTGTGCCCCT
TACGCGGAAAAGTTTTGTACGTCATGGGCTGCCCTTCCCCTCCTGGCCATGTGCGCTGCTGACCATCGCACAGTT
TTCTCGGATGGAAAGAAATCTGGCAGATTTTCTGATGGCTAGGGGAGTGCAAGCTCCGGCTCCCACCGCTCCTGG
TGCAAATTACAAGCCGCCTGTTCGGACGAGCAGATGACGTTGGCGGGCGGCTACAGCGACAGTCGTGAATCACGG
ACGAAGTTTCGGGACCGGTGAGCGCCGAATTGAGCGGATCCATGAGTCTACAGAGTCACGCGCCAGCCTGCTTGG
TGTATGAATCACAGCTTGAGCTTGACGCAATGAGTTTGCCCGTTTGCTCTGGCCCGCCGTCTATAAATGTGCCTC
CTCCTCCCCTCTGTCCTTCTGTTTCCTTTCAGTACTACGCCATAGAAACCAGCATCATCGCAGACTCGGATCGCC
ACCCTCATTGCACACGCTGTCGAAAATAAGCTGAGCCCCCGAACATCGTCAGACTTCCAAAGCTCGCTCTCTTCC
TTTCTGACTTCTCGACACCATGGGTGGAAGGATCTGGGACAAGAACGAGGAGGAGCACTTCTGGAACACCATCGT
TCCCAAGTCTCCCGTCGCCGCGGATGGTAAGGGCCTGCAGATGAGCTGGGTCGCCCTGGCCGAGGAAATGAGGAA
TAAGTTCGGAGGAAGTCGCCGCAATTACACGTGGCTGATGCTCTGTAAACACCGACCAGCCCCGGAAGACCATCG
AACGCTGCTAATCTGTTCAAGATGAGCATTGGTACCAGAACGCGCGGACCGGGCATTCGTCGCCACATGGGCGAC
ACCTGGTCGCAGAATACAAGAGGCAGATCGGTGAGTCTCGGCCTAGGACATGAGTTGACGCTCTAACGTACTCAC
TCTTGTTCAAACACAGCGACCTGCGTCAAGCCGGCTGTCATCATGAAGCCGGTAAACAAGCCGGCCACCAAGCCG
GTGAACAAGACGGCGGCTCGACGGTCCGCGACAGCTGGTCGGACCCGGGTGGTCAAACGGTCAGCACAGAGGCCG
TCTGCCAGCTGTGGTCGAACGAGGCCGCTGGTCGGCGAGTCGGCCGCGGTGAAAGCCGATATCGACGGCGGCCTC
CAGGGGCCAACATGTGCTCCTCGCCCGGCGCCGACAAATCCGGGCTTTCACGGCAGCTTCGTCGTCCACGGTTCA
GCCGTGGGACCGCAGGCCTGGATCCCCGGGCTCATCTCAGAGGGTCCGGGCTATGGGTCCAGTGCCTCGGTTCTG
TGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail