Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2186
Gene name
LocationContig_203:1549..4319
Strand-
Gene length (bp)2770
Transcript length (bp)2445
Coding sequence length (bp)2445
Protein length (aa) 815

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06027 SLC35F Solute carrier family 35 4.2E-92 466 760
PF05205 COMPASS-Shg1 COMPASS (Complex proteins associated with Set1p) component shg1 2.1E-26 43 143

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O59785|YCN8_SCHPO Uncharacterized solute carrier family 35 member C320.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC320.08 PE=1 SV=1 417 789 2.0E-90
sp|Q8IXU6|S35F2_HUMAN Solute carrier family 35 member F2 OS=Homo sapiens GN=SLC35F2 PE=1 SV=1 426 759 1.0E-57
sp|Q5T1Q4|S35F1_HUMAN Solute carrier family 35 member F1 OS=Homo sapiens GN=SLC35F1 PE=2 SV=2 473 759 9.0E-57
sp|Q8BGK5|S35F1_MOUSE Solute carrier family 35 member F1 OS=Mus musculus GN=Slc35f1 PE=1 SV=1 473 759 2.0E-56
sp|Q7TML3|S35F2_MOUSE Solute carrier family 35 member F2 OS=Mus musculus GN=Slc35f2 PE=1 SV=2 473 759 1.0E-54
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O59785|YCN8_SCHPO Uncharacterized solute carrier family 35 member C320.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC320.08 PE=1 SV=1 417 789 2.0E-90
sp|Q8IXU6|S35F2_HUMAN Solute carrier family 35 member F2 OS=Homo sapiens GN=SLC35F2 PE=1 SV=1 426 759 1.0E-57
sp|Q5T1Q4|S35F1_HUMAN Solute carrier family 35 member F1 OS=Homo sapiens GN=SLC35F1 PE=2 SV=2 473 759 9.0E-57
sp|Q8BGK5|S35F1_MOUSE Solute carrier family 35 member F1 OS=Mus musculus GN=Slc35f1 PE=1 SV=1 473 759 2.0E-56
sp|Q7TML3|S35F2_MOUSE Solute carrier family 35 member F2 OS=Mus musculus GN=Slc35f2 PE=1 SV=2 473 759 1.0E-54
sp|Q0V9U2|S35F2_XENTR Solute carrier family 35 member F2 OS=Xenopus tropicalis GN=slc35f2 PE=2 SV=2 473 760 3.0E-49
sp|F1QBY1|NIPLB_DANRE Nipped-B-like protein B OS=Danio rerio GN=nipblb PE=2 SV=1 142 423 7.0E-33
sp|F1QBY1|NIPLB_DANRE Nipped-B-like protein B OS=Danio rerio GN=nipblb PE=2 SV=1 80 376 3.0E-22
sp|F1QBY1|NIPLB_DANRE Nipped-B-like protein B OS=Danio rerio GN=nipblb PE=2 SV=1 116 361 7.0E-21
sp|F1QBY1|NIPLB_DANRE Nipped-B-like protein B OS=Danio rerio GN=nipblb PE=2 SV=1 139 387 6.0E-17
sp|F1QBY1|NIPLB_DANRE Nipped-B-like protein B OS=Danio rerio GN=nipblb PE=2 SV=1 148 354 6.0E-13
sp|Q9LFE0|DOT2_ARATH SART-1 family protein DOT2 OS=Arabidopsis thaliana GN=DOT2 PE=1 SV=1 213 346 6.0E-13
sp|Q8IDX6|RBP2A_PLAF7 Reticulocyte-binding protein 2 homolog a OS=Plasmodium falciparum (isolate 3D7) GN=PF13_0198 PE=3 SV=1 188 360 3.0E-11
sp|G4SLH0|TTN1_CAEEL Titin homolog OS=Caenorhabditis elegans GN=ttn-1 PE=1 SV=2 146 386 1.0E-07
sp|Q6PGZ3|MIPT3_DANRE TRAF3-interacting protein 1 OS=Danio rerio GN=traf3ip1 PE=2 SV=1 220 326 2.0E-07
sp|Q5XIN3|MIPT3_RAT TRAF3-interacting protein 1 OS=Rattus norvegicus GN=Traf3ip1 PE=1 SV=1 152 332 3.0E-07
sp|Q92576|PHF3_HUMAN PHD finger protein 3 OS=Homo sapiens GN=PHF3 PE=1 SV=3 227 343 3.0E-07
sp|Q8IDX6|RBP2A_PLAF7 Reticulocyte-binding protein 2 homolog a OS=Plasmodium falciparum (isolate 3D7) GN=PF13_0198 PE=3 SV=1 188 384 7.0E-07
sp|Q8SX83|SPEN_DROME Protein split ends OS=Drosophila melanogaster GN=spen PE=1 SV=2 209 348 4.0E-06
sp|F4IAT2|THOC2_ARATH THO complex subunit 2 OS=Arabidopsis thaliana GN=THO2 PE=1 SV=1 214 348 7.0E-06
sp|O23212|U2A2A_ARATH Splicing factor U2af large subunit A OS=Arabidopsis thaliana GN=U2AF65A PE=2 SV=2 224 312 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0051179 localization No
GO:0005215 transporter activity No
GO:0051234 establishment of localization No
GO:0003674 molecular_function No
GO:0009987 cellular process No
GO:0005575 cellular_component No
GO:0006810 transport No
GO:0110165 cellular anatomical entity No
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 35 0.45

Transmembrane Domains

Domain # Start End Length
1 469 491 22
2 498 520 22
3 561 583 22
4 592 611 19
5 626 648 22
6 655 673 18
7 688 710 22
8 717 739 22
9 744 766 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2186
MAAPTQPVAGGNAPAAGDGRSAARKFKASDLPLPSATRAAIESLAHNFKKEGAYDSIRKQVWDKFEASDYEAQVT
KAILEVAEQEVERNPQQLLTLDRRKAAALIDGALERSGVYQKAEQVIDQLIDVGAIEARIREIRRAEIGDEAEAE
RLRGLKTDEQYAAETEARRADRERAREELRQKEAAIEEEKQRVAREERKKEEKEREQAELRRQAEREEKRRKREE
ERAEREKQRVKERDERIKERERREKQRDAERERERERGRERDRDRERDRDRERERDRDRDRDRDRDRNRDRDRDR
DRDRERDRDRERPKDRDRDRDKDRDRNRDTDRDRHRHRERSNRPANPETASAELTKEEDERLEREALADLLRESN
KAARAQPELEVDAALAPPPRRSGPTSAINPIRKDSTKPSAADPAPVKPVPQEAHPDAHPEAHPDAEAAAAGIALL
ESRRPKRWYGYVTSADFCIVAFLGQVLALCITATNTFTTLLARADFNAPALQTCFNYAFIGSVFTTVFLIRDGPR
PWFRALRSRGWRYLLLAALDVEANYFTVLAYQHTTILSAQLINFWSIVCVVAVSALVLKVRYRPQQLLGILVCCA
GMGLLIATDHLGQRNGGPAKDALRGDLFALLGATLYGLSNVFEEWLVSKDAAHHVLGFLGLFGLIINGVQAAIFD
RASLATTAWSGPIAGWLVGYTACLSLFYSLAPLVLRMASAAFFDVSLLTANFWGVIIGVRLFGYSVHFLYPVAFL
CIVAGLMLYFVAGSLLGDAQKPWLARDQHDGVAGVGTAKLRAMNAARGGPEGVWERVKRGMAFA*
Coding >Ophun1|2186
ATGGCGGCTCCTACACAGCCCGTGGCAGGCGGCAATGCCCCAGCGGCTGGTGATGGTCGATCGGCTGCTCGCAAG
TTCAAAGCTTCGGATCTGCCGCTGCCTTCAGCTACGCGCGCGGCCATCGAATCGCTTGCACATAATTTCAAGAAG
GAGGGCGCCTACGACTCGATCCGAAAGCAAGTCTGGGACAAGTTCGAAGCTAGCGACTACGAAGCTCAGGTCACC
AAGGCTATTCTCGAGGTCGCGGAGCAAGAAGTGGAGCGAAACCCGCAACAGCTTCTCACTCTCGACCGGCGGAAG
GCGGCAGCTCTGATTGACGGCGCCCTAGAGCGCTCCGGCGTCTATCAAAAGGCAGAGCAAGTCATCGACCAGCTC
ATCGATGTCGGAGCCATCGAAGCCAGAATCCGCGAGATCCGTCGGGCGGAAATCGGCGACGAGGCCGAGGCTGAA
AGGCTGCGCGGACTCAAGACGGACGAGCAGTACGCTGCAGAGACGGAAGCGAGAAGGGCCGATCGCGAGCGGGCC
CGAGAGGAACTGAGACAGAAAGAGGCTGCCATCGAGGAAGAGAAGCAGCGGGTTGCGCGGGAAGAACGAAAGAAG
GAAGAAAAGGAGCGCGAACAAGCTGAGCTTAGAAGGCAGGCTGAGCGCGAAGAGAAGAGGCGAAAGAGGGAGGAG
GAGAGAGCAGAGAGGGAGAAGCAGCGGGTCAAAGAGCGGGACGAGCGTATCAAGGAACGGGAGCGTCGAGAGAAA
CAACGCGATGCGGAGCGGGAACGGGAGCGTGAACGGGGGCGCGAGAGAGACCGAGATCGAGAGAGAGACCGAGAC
CGAGAGAGGGAGAGAGACCGAGACCGCGACAGGGACCGCGACCGCGACAGAAACCGCGACAGAGACAGAGATCGA
GACCGCGACCGGGAACGAGACAGAGATCGAGAGCGACCCAAAGACAGAGATCGAGATCGCGACAAAGACAGAGAC
CGCAACCGCGACACAGACAGAGACCGCCATCGTCATCGTGAGCGAAGCAACCGCCCAGCGAACCCCGAGACCGCG
TCTGCAGAGCTCACCAAAGAGGAAGACGAAAGACTCGAGCGGGAGGCCCTTGCCGACCTCCTCCGCGAGAGCAAC
AAGGCTGCCCGAGCGCAACCCGAGCTGGAGGTGGATGCAGCTCTGGCGCCACCGCCCCGAAGAAGCGGCCCTACG
TCTGCCATCAACCCCATCCGCAAAGACTCGACCAAGCCGTCGGCAGCCGATCCCGCGCCCGTCAAGCCCGTCCCC
CAAGAAGCCCATCCCGACGCCCATCCAGAAGCCCATCCCGACGCCGAAGCCGCCGCCGCAGGGATCGCCCTCTTG
GAAAGCAGACGTCCCAAACGATGGTACGGCTACGTAACCTCTGCCGACTTTTGCATCGTCGCCTTTCTCGGTCAG
GTTCTCGCCCTCTGCATCACCGCGACGAATACCTTTACCACGCTCCTCGCCCGCGCGGATTTCAACGCCCCGGCT
CTGCAGACGTGCTTCAACTACGCCTTCATCGGCTCCGTCTTCACCACCGTCTTCCTCATCCGCGATGGGCCGCGC
CCGTGGTTTCGAGCCCTGCGCTCGCGGGGATGGCGGTACTTGTTGCTCGCGGCCCTCGACGTCGAGGCCAATTAC
TTTACCGTTCTCGCGTACCAGCACACGACGATTCTATCCGCCCAGCTCATCAACTTTTGGTCCATCGTCTGCGTA
GTCGCCGTCTCGGCCCTCGTCCTCAAGGTCCGCTACCGCCCACAGCAACTCCTCGGCATCCTCGTCTGCTGCGCC
GGCATGGGCCTCCTCATCGCCACGGATCATCTGGGTCAGCGCAACGGCGGTCCCGCCAAGGATGCCCTCCGCGGC
GACCTCTTCGCCCTGCTGGGCGCGACGCTGTACGGCCTCAGCAACGTGTTTGAAGAGTGGCTGGTCAGCAAAGAC
GCAGCCCACCACGTGCTCGGCTTCCTCGGCCTCTTCGGCCTCATCATCAACGGCGTGCAGGCCGCCATCTTCGAC
CGGGCGAGCCTGGCCACGACGGCGTGGTCCGGTCCGATAGCGGGCTGGCTGGTGGGCTACACGGCGTGCCTGTCA
CTGTTCTACTCGCTGGCGCCGCTGGTGCTGCGGATGGCGAGCGCCGCCTTCTTCGACGTGTCGCTGCTGACGGCC
AACTTTTGGGGCGTCATCATTGGCGTGCGCTTGTTTGGCTACAGCGTGCACTTTTTGTACCCGGTGGCATTCCTG
TGCATCGTCGCCGGGTTGATGTTGTACTTTGTGGCGGGGAGCTTGCTGGGAGACGCGCAGAAGCCGTGGCTCGCG
CGGGATCAGCACGATGGGGTTGCGGGGGTTGGGACGGCCAAGTTGAGGGCCATGAATGCGGCACGGGGGGGGCCT
GAGGGGGTTTGGGAGCGGGTGAAGAGGGGGATGGCGTTTGCGTGA
Transcript >Ophun1|2186
ATGGCGGCTCCTACACAGCCCGTGGCAGGCGGCAATGCCCCAGCGGCTGGTGATGGTCGATCGGCTGCTCGCAAG
TTCAAAGCTTCGGATCTGCCGCTGCCTTCAGCTACGCGCGCGGCCATCGAATCGCTTGCACATAATTTCAAGAAG
GAGGGCGCCTACGACTCGATCCGAAAGCAAGTCTGGGACAAGTTCGAAGCTAGCGACTACGAAGCTCAGGTCACC
AAGGCTATTCTCGAGGTCGCGGAGCAAGAAGTGGAGCGAAACCCGCAACAGCTTCTCACTCTCGACCGGCGGAAG
GCGGCAGCTCTGATTGACGGCGCCCTAGAGCGCTCCGGCGTCTATCAAAAGGCAGAGCAAGTCATCGACCAGCTC
ATCGATGTCGGAGCCATCGAAGCCAGAATCCGCGAGATCCGTCGGGCGGAAATCGGCGACGAGGCCGAGGCTGAA
AGGCTGCGCGGACTCAAGACGGACGAGCAGTACGCTGCAGAGACGGAAGCGAGAAGGGCCGATCGCGAGCGGGCC
CGAGAGGAACTGAGACAGAAAGAGGCTGCCATCGAGGAAGAGAAGCAGCGGGTTGCGCGGGAAGAACGAAAGAAG
GAAGAAAAGGAGCGCGAACAAGCTGAGCTTAGAAGGCAGGCTGAGCGCGAAGAGAAGAGGCGAAAGAGGGAGGAG
GAGAGAGCAGAGAGGGAGAAGCAGCGGGTCAAAGAGCGGGACGAGCGTATCAAGGAACGGGAGCGTCGAGAGAAA
CAACGCGATGCGGAGCGGGAACGGGAGCGTGAACGGGGGCGCGAGAGAGACCGAGATCGAGAGAGAGACCGAGAC
CGAGAGAGGGAGAGAGACCGAGACCGCGACAGGGACCGCGACCGCGACAGAAACCGCGACAGAGACAGAGATCGA
GACCGCGACCGGGAACGAGACAGAGATCGAGAGCGACCCAAAGACAGAGATCGAGATCGCGACAAAGACAGAGAC
CGCAACCGCGACACAGACAGAGACCGCCATCGTCATCGTGAGCGAAGCAACCGCCCAGCGAACCCCGAGACCGCG
TCTGCAGAGCTCACCAAAGAGGAAGACGAAAGACTCGAGCGGGAGGCCCTTGCCGACCTCCTCCGCGAGAGCAAC
AAGGCTGCCCGAGCGCAACCCGAGCTGGAGGTGGATGCAGCTCTGGCGCCACCGCCCCGAAGAAGCGGCCCTACG
TCTGCCATCAACCCCATCCGCAAAGACTCGACCAAGCCGTCGGCAGCCGATCCCGCGCCCGTCAAGCCCGTCCCC
CAAGAAGCCCATCCCGACGCCCATCCAGAAGCCCATCCCGACGCCGAAGCCGCCGCCGCAGGGATCGCCCTCTTG
GAAAGCAGACGTCCCAAACGATGGTACGGCTACGTAACCTCTGCCGACTTTTGCATCGTCGCCTTTCTCGGTCAG
GTTCTCGCCCTCTGCATCACCGCGACGAATACCTTTACCACGCTCCTCGCCCGCGCGGATTTCAACGCCCCGGCT
CTGCAGACGTGCTTCAACTACGCCTTCATCGGCTCCGTCTTCACCACCGTCTTCCTCATCCGCGATGGGCCGCGC
CCGTGGTTTCGAGCCCTGCGCTCGCGGGGATGGCGGTACTTGTTGCTCGCGGCCCTCGACGTCGAGGCCAATTAC
TTTACCGTTCTCGCGTACCAGCACACGACGATTCTATCCGCCCAGCTCATCAACTTTTGGTCCATCGTCTGCGTA
GTCGCCGTCTCGGCCCTCGTCCTCAAGGTCCGCTACCGCCCACAGCAACTCCTCGGCATCCTCGTCTGCTGCGCC
GGCATGGGCCTCCTCATCGCCACGGATCATCTGGGTCAGCGCAACGGCGGTCCCGCCAAGGATGCCCTCCGCGGC
GACCTCTTCGCCCTGCTGGGCGCGACGCTGTACGGCCTCAGCAACGTGTTTGAAGAGTGGCTGGTCAGCAAAGAC
GCAGCCCACCACGTGCTCGGCTTCCTCGGCCTCTTCGGCCTCATCATCAACGGCGTGCAGGCCGCCATCTTCGAC
CGGGCGAGCCTGGCCACGACGGCGTGGTCCGGTCCGATAGCGGGCTGGCTGGTGGGCTACACGGCGTGCCTGTCA
CTGTTCTACTCGCTGGCGCCGCTGGTGCTGCGGATGGCGAGCGCCGCCTTCTTCGACGTGTCGCTGCTGACGGCC
AACTTTTGGGGCGTCATCATTGGCGTGCGCTTGTTTGGCTACAGCGTGCACTTTTTGTACCCGGTGGCATTCCTG
TGCATCGTCGCCGGGTTGATGTTGTACTTTGTGGCGGGGAGCTTGCTGGGAGACGCGCAGAAGCCGTGGCTCGCG
CGGGATCAGCACGATGGGGTTGCGGGGGTTGGGACGGCCAAGTTGAGGGCCATGAATGCGGCACGGGGGGGGCCT
GAGGGGGTTTGGGAGCGGGTGAAGAGGGGGATGGCGTTTGCGTGA
Gene >Ophun1|2186
ATGGCGGCTCCTACACAGCCCGTGGCAGGCGGCAATGCCCCAGCGGCTGGTGATGGTCGATCGGCTGCTCGCAAG
TTCAAAGCTTCGGATCTGCCGCTGCCTTCAGCTACGCGCGCGGCCATCGAATCGCTTGCACATAATTTCAAGAAG
GAGGGCGCCTACGACTCGATCCGAAAGCAAGTCTGGGACAAGTTCGAAGCTAGCGTAAGAATTTCTCTCATCAAT
CGACGCTCACCATGCTGACAGTCTGCTCAATAGGACTACGAAGCTCAGGTCACCAAGGCTATTCTCGAGGTCGCG
GAGCAAGAAGTGGAGCGAAACCCGCAACAGCTTCTCACTCTCGACCGGCGGAAGGCGGCAGCTCTGATTGACGGC
GCCCTAGAGCGCTCCGGCGTCTATCAAAAGGCAGAGCAAGTCATCGACCAGCTCATCGATGTCGGAGCCATCGAA
GCCAGAATCCGCGAGATCCGTCGGGCGGAAATCGGCGACGAGGCCGAGGCTGAAAGGCTGCGCGGACTCAAGACG
GACGAGCAGTACGCTGCAGAGACGGAAGCGAGAAGGGCCGATCGCGAGCGGGCCCGAGAGGAACTGAGACAGAAA
GAGGCTGCCATCGAGGAAGAGAAGCAGCGGGTTGCGCGGGAAGAACGAAAGAAGGAAGAAAAGGAGCGCGAACAA
GCTGAGCTTAGAAGGCAGGCTGAGCGCGAAGAGAAGAGGCGAAAGAGGGAGGAGGAGAGAGCAGAGAGGGAGAAG
CAGCGGGTCAAAGAGCGGGACGAGCGTATCAAGGAACGGGAGCGTCGAGAGAAACAACGCGATGCGGAGCGGGAA
CGGGAGCGTGAACGGGGGCGCGAGAGAGACCGAGATCGAGAGAGAGACCGAGACCGAGAGAGGGAGAGAGACCGA
GACCGCGACAGGGACCGCGACCGCGACAGAAACCGCGACAGAGACAGAGATCGAGACCGCGACCGGGAACGAGAC
AGAGATCGAGAGCGACCCAAAGACAGAGATCGAGATCGCGACAAAGACAGAGACCGCAACCGCGACACAGACAGA
GACCGCCATCGTCATCGTGAGCGAAGCAACCGCCCAGCGAACCCCGAGACCGCGTCTGCAGAGCTCACCAAAGAG
GAAGACGAAAGACTCGAGCGGGAGGCCCTTGCCGACCTCCTCCGCGAGAGCAACAAGGCTGCCCGAGCGCAACCC
GAGCTGGAGGTGGATGCAGCTCTGGCGCCACCGCCCCGAAGAAGCGGCCCTACGTCTGCCATCAACCCCATCCGC
AAAGACTCGACCAAGCCGTCGGCAGGTAAGGATACGAAGCCCGCGGTCAAAGACAGGAGCAGGAGCAGAAGTCCT
TCGCGGGCTGGCAACCGTACAAGAGAACGGAGTGCGGTTCGCGACAACCGACGTCAGCAGAACAGACGATCGCCG
TCTCCTCGCAGAGACGACAGACGATCTTGGTCCCGCCGCAGAGATGACAGGCGATCCCGATCCCCCCGAAGACGC
GACAGTCGCTCCCACGACAGATGGACGCGTCTAGACGAGAGTCGAGCTGGTCGCCTTCGAGACAACCGCAGCCGA
TCCCGCGCCCGTCAAGCCCGTCCCCCAAGAAGCCCATCCCGACGCCCATCCAGAAGCCCATCCCGACGCCGAAGC
CGCCGCCGCAGGGATCGCCCTCTTGGAAAGCAGACGTCCCAAACGATGGTACGGCTACGTAACCTCTGCCGACTT
TTGCATCGTCGCCTTTCTCGGTCAGGTTCTCGCCCTCTGCATCACCGCGACGAATACCTTTACCACGCTCCTCGC
CCGCGCGGATTTCAACGCCCCGGCTCTGCAGACGTGCTTCAACTACGCCTTCATCGGCTCCGTCTTCACCACCGT
CTTCCTCATCCGCGATGGGCCGCGCCCGTGGTTTCGAGCCCTGCGCTCGCGGGGATGGCGGTACTTGTTGCTCGC
GGCCCTCGACGTCGAGGCCAATTACTTTACCGTTCTCGCGTACCAGCACACGACGATTCTATCCGCCCAGCTCAT
CAACTTTTGGTCCATCGTCTGCGTAGTCGCCGTCTCGGCCCTCGTCCTCAAGGTCCGCTACCGCCCACAGCAACT
CCTCGGCATCCTCGTCTGCTGCGCCGGCATGGGCCTCCTCATCGCCACGGATCATCTGGGTCAGCGCAACGGCGG
TCCCGCCAAGGATGCCCTCCGCGGCGACCTCTTCGCCCTGCTGGGCGCGACGCTGTACGGCCTCAGCAACGTGTT
TGAAGAGTGGCTGGTCAGCAAAGACGCAGCCCACCACGTGCTCGGCTTCCTCGGCCTCTTCGGCCTCATCATCAA
CGGCGTGCAGGCCGCCATCTTCGACCGGGCGAGCCTGGCCACGACGGCGTGGTCCGGTCCGATAGCGGGCTGGCT
GGTGGGCTACACGGCGTGCCTGTCACTGTTCTACTCGCTGGCGCCGCTGGTGCTGCGGATGGCGAGCGCCGCCTT
CTTCGACGTGTCGCTGCTGACGGCCAACTTTTGGGGCGTCATCATTGGCGTGCGCTTGTTTGGCTACAGCGTGCA
CTTTTTGTACCCGGTGGCATTCCTGTGCATCGTCGCCGGGTTGATGTTGTACTTTGTGGCGGGGAGCTTGCTGGG
AGACGCGCAGAAGCCGTGGCTCGCGCGGGATCAGCACGATGGGGTTGCGGGGGTTGGGACGGCCAAGTTGAGGGC
CATGAATGCGGCACGGGGGGGGCCTGAGGGGGTTTGGGAGCGGGTGAAGAGGGGGATGGCGTTTGCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail