Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|218
Gene name
LocationContig_1044:765..2531
Strand+
Gene length (bp)1766
Transcript length (bp)1221
Coding sequence length (bp)1221
Protein length (aa) 407

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06966 DUF1295 Protein of unknown function (DUF1295) 1.6E-29 229 388
PF08547 CIA30 Complex I intermediate-associated protein 30 (CIA30) 2.8E-20 17 123

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O14297|YF1F_SCHPO Uncharacterized protein C9E9.15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC9E9.15 PE=3 SV=2 6 102 4.0E-12

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 40 0.45

Transmembrane Domains

Domain # Start End Length
1 163 185 22
2 198 217 19
3 232 254 22
4 275 297 22
5 307 329 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|218
MHDERLLHLFGGDQPWRPSDWEASDDRVRNGKSHSTLTIPACAETALFTGTLDTQTLGGAGFASQRTSNRSLALD
LRPYAGLVLSLGARGGDGKRYALTLTDETPRRRPDGRDEAVVSWEAVFVGGLAEKEVRFRQPTSPPSTPLKMPLL
QGLLRLTTHRSPLLATLLPTALTAFALQAAVGIPSSAAATERFYDISGSATVLAVGALGLCLPSLRAEGRWVGWR
AVLAGRTWGQIAVTAMAVVWTCRLGSYLFQRVLSEGKDSRFDKMRDRPALMLAAFAAQACWVTAIMTPVIALNAC
PPAALPPLGALQALGFILWASGMTLEVVADRQKGKWLEGRRNKQHDEPFLSSGLYSFCRFPNYLGEITLWSGVAT
VSAAALAASSAQAALGLRGGVGVLVTTGLAV*
Coding >Ophun1|218
ATGCACGACGAGAGGCTGCTACATCTGTTTGGCGGCGACCAGCCCTGGCGCCCATCCGACTGGGAAGCCTCCGAC
GACCGCGTCCGCAACGGAAAATCCCACTCAACGCTCACAATCCCCGCCTGCGCCGAAACCGCCCTCTTCACCGGC
ACCCTCGACACCCAAACCCTCGGCGGCGCCGGCTTCGCCTCCCAACGAACCTCCAACCGCAGCCTAGCCCTCGAC
CTACGCCCCTACGCCGGCCTCGTCCTCTCCCTCGGCGCCCGCGGCGGCGACGGCAAGCGCTACGCCCTCACCCTC
ACGGACGAGACGCCCCGGCGGAGGCCCGACGGGAGGGACGAGGCTGTCGTCTCGTGGGAGGCCGTCTTTGTGGGC
GGGCTGGCGGAGAAGGAGGTGCGGTTCCGCCAACCAACCTCTCCTCCCTCAACTCCCCTCAAAATGCCTCTCCTC
CAAGGCCTCCTCCGCCTCACAACCCACCGCTCCCCCCTCCTAGCAACCCTCCTCCCCACCGCCCTCACAGCCTTC
GCCCTGCAAGCCGCCGTCGGCATCCCCTCCTCGGCCGCCGCCACCGAGCGCTTCTACGACATCTCGGGCTCAGCC
ACCGTCCTGGCCGTCGGCGCTCTCGGCCTGTGTCTCCCCAGCTTGAGGGCCGAGGGGCGCTGGGTTGGCTGGAGG
GCTGTGCTTGCGGGGAGGACGTGGGGGCAGATTGCCGTTACGGCCATGGCGGTTGTGTGGACGTGTCGTCTTGGC
TCGTATCTCTTCCAGAGGGTTCTTTCTGAGGGCAAAGATTCGCGCTTTGATAAGATGAGGGATCGGCCCGCGCTG
ATGCTCGCTGCCTTTGCCGCGCAGGCTTGCTGGGTAACGGCGATAATGACGCCCGTCATAGCCCTCAACGCCTGC
CCCCCCGCCGCCCTGCCCCCCCTAGGCGCCCTGCAAGCCCTCGGCTTCATCCTCTGGGCCAGCGGCATGACGCTC
GAAGTCGTCGCCGACCGCCAAAAGGGGAAATGGCTGGAGGGCCGCCGCAACAAACAACACGACGAGCCCTTCCTC
TCCTCCGGCCTATACTCGTTCTGCCGCTTCCCCAACTACCTGGGCGAGATCACGCTCTGGTCCGGCGTGGCGACC
GTCTCGGCCGCCGCGCTGGCGGCGTCTTCGGCGCAGGCGGCCTTAGGGTTGAGGGGGGGGGTGGGCGTGCTGGTC
ACGACGGGGTTGGCGGTTTGA
Transcript >Ophun1|218
ATGCACGACGAGAGGCTGCTACATCTGTTTGGCGGCGACCAGCCCTGGCGCCCATCCGACTGGGAAGCCTCCGAC
GACCGCGTCCGCAACGGAAAATCCCACTCAACGCTCACAATCCCCGCCTGCGCCGAAACCGCCCTCTTCACCGGC
ACCCTCGACACCCAAACCCTCGGCGGCGCCGGCTTCGCCTCCCAACGAACCTCCAACCGCAGCCTAGCCCTCGAC
CTACGCCCCTACGCCGGCCTCGTCCTCTCCCTCGGCGCCCGCGGCGGCGACGGCAAGCGCTACGCCCTCACCCTC
ACGGACGAGACGCCCCGGCGGAGGCCCGACGGGAGGGACGAGGCTGTCGTCTCGTGGGAGGCCGTCTTTGTGGGC
GGGCTGGCGGAGAAGGAGGTGCGGTTCCGCCAACCAACCTCTCCTCCCTCAACTCCCCTCAAAATGCCTCTCCTC
CAAGGCCTCCTCCGCCTCACAACCCACCGCTCCCCCCTCCTAGCAACCCTCCTCCCCACCGCCCTCACAGCCTTC
GCCCTGCAAGCCGCCGTCGGCATCCCCTCCTCGGCCGCCGCCACCGAGCGCTTCTACGACATCTCGGGCTCAGCC
ACCGTCCTGGCCGTCGGCGCTCTCGGCCTGTGTCTCCCCAGCTTGAGGGCCGAGGGGCGCTGGGTTGGCTGGAGG
GCTGTGCTTGCGGGGAGGACGTGGGGGCAGATTGCCGTTACGGCCATGGCGGTTGTGTGGACGTGTCGTCTTGGC
TCGTATCTCTTCCAGAGGGTTCTTTCTGAGGGCAAAGATTCGCGCTTTGATAAGATGAGGGATCGGCCCGCGCTG
ATGCTCGCTGCCTTTGCCGCGCAGGCTTGCTGGGTAACGGCGATAATGACGCCCGTCATAGCCCTCAACGCCTGC
CCCCCCGCCGCCCTGCCCCCCCTAGGCGCCCTGCAAGCCCTCGGCTTCATCCTCTGGGCCAGCGGCATGACGCTC
GAAGTCGTCGCCGACCGCCAAAAGGGGAAATGGCTGGAGGGCCGCCGCAACAAACAACACGACGAGCCCTTCCTC
TCCTCCGGCCTATACTCGTTCTGCCGCTTCCCCAACTACCTGGGCGAGATCACGCTCTGGTCCGGCGTGGCGACC
GTCTCGGCCGCCGCGCTGGCGGCGTCTTCGGCGCAGGCGGCCTTAGGGTTGAGGGGGGGGGTGGGCGTGCTGGTC
ACGACGGGGTTGGCGGTTTGA
Gene >Ophun1|218
ATGCACGACGAGAGGCTGCTACATCTGTTTGGCGGCGACCAGTACGCTCATCAATACCATCCATCCCTTCAGTTC
CCTCTCCCCCGAAGCTAACGGAATCCCCCAGGCCCTGGCGCCCATCCGACTGGGAAGCCTCCGACGACCGCGTCC
GCAACGGAAAATCCCACTCAACGCTCACAATCCCCGCCTGCGCCGAAACCGCCCTCTTCACCGGCACCCTCGACA
CCCAAACCCTCGGCGGCGCCGGCTTCGCCTCCCAACGAACCTCCAACCGCAGCCTAGCCCTCGACCTACGCCCCT
ACGCCGGCCTCGTCCTCTCCCTCGGCGCCCGCGGCGGCGACGGCAAGCGCTACGCCCTCACCCTCACGGACGAGA
CGCCCCGGCGGAGGCCCGACGGGAGGGACGAGGCTGTCGTCTCGTGGGAGGCCGTCTTTGTGGGCGGGCTGGCGG
AGAAGGAGGTGCGGTTCCGGTGGGCGGATTTCGTGCCGACTTATAGGGGGAGGGTTGTCAAGGGCAGGGAGTTGG
ATTTGGGGGGGGTGAGGAGGGTGGGGATTATGATGAGGAGTTTCTTTGGGGAGCAGAGTGGGGAGTTTGAGTTGG
AGATGAGGGCGATTTCTGCGTTTGGGGGGAGGGAGGAGGAGGAGGAGAAGGAGGTTATTGGCGGGAAACGGTCGT
GGGGAGGCATGTTTTGCTGCTTTGCGTAGATGGTAGTGGTGGTTGAGGTGGTGTTGAAGTGGTGTCGTCACATGT
AGAATGTTATGTCGTCATCACTTTGCTAGCTTACACAGCTCCCGCCATTGAACCTCTCCTCCATCAAACCTCTCT
TCACAACATACACAGCCAACCAACCTCTCCTCCCTCAACTCCCCTCAAAATGCCTCTCCTCCAAGGCCTCCTCCG
CCTCACAACCCACCGCTCCCCCCTCCTAGCAACCCTCCTCCCCACCGCCCTCACAGCCTTCGCCCTGCAAGCCGC
CGTCGGCATCCCCTCCTCGGCCGCCGCCACCGAGCGCTTCTACGACATCTCGGGCTCAGCCACCGTCCTGGCCGT
CGGCGCTCTCGGCCTGTGTCTCCCCAGCTTGAGGGCCGAGGGGCGCTGGGTTGGCTGGAGGGCTGTGCTTGCGGG
GAGGACGTGGGGGCAGATTGCCGTTACGGCCATGGCGGTTGTGTGGACGTGTCGTCGTGAGTTTCTCTCTTGGTG
GTTTGGGGGGGGTCGGTGATGCTGATGGGTGTAGTTGGCTCGTATCTCTTCCAGAGGGTTCTTTCTGAGGGCAAA
GATTCGCGCTTTGATAAGATGAGGGATCGGCCCGCGCTGATGCTCGCTGCCTTTGCCGCGCAGGCTTGCTGGGTA
ACGGCGATAATGACGCCCGTCATAGCCCTCAACGCCTGCCCCCCCGCCGCCCTGCCCCCCCTAGGCGCCCTGCAA
GCCCTCGGCTTCATCCTCTGGGCCAGCGGCATGACGCTCGAAGTCGTCGCCGACCGCCAAAAGGGGAAATGGCTG
GAGGGCCGCCGCAACAAACAACACGACGAGCCCTTCCTCTCCTCCGGCCTATACTCGTTCTGCCGCTTCCCCAAC
TACCTGGGCGAGATCACGCTCTGGTCCGGCGTGGCGACCGTCTCGGCCGCCGCGCTGGCGGCGTCTTCGGCGCAG
GCGGCCTTAGGGTTGAGGGGGGGGGTGGGCGTGCTGGTCACGACGGGGTTGGCGGTTGTGAGTCCGGCTATGACG
GCGTTTCTGCTGACGTGCGTTTCGGGGATTCCGCTTAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail