Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2173
Gene name
LocationContig_202:2359..4225
Strand-
Gene length (bp)1866
Transcript length (bp)1866
Coding sequence length (bp)1866
Protein length (aa) 622

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05686 Glyco_transf_90 Glycosyl transferase family 90 1.9E-14 492 606

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5K8R6|CXT1_CRYNJ Beta-1,2-xylosyltransferase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CXT1 PE=1 SV=1 43 610 8.0E-45
sp|Q566E5|KDEL2_RAT KDEL motif-containing protein 2 OS=Rattus norvegicus GN=Kdelc2 PE=2 SV=1 487 609 1.0E-09
sp|Q6UW63|KDEL1_HUMAN KDEL motif-containing protein 1 OS=Homo sapiens GN=KDELC1 PE=1 SV=1 490 605 1.0E-09
sp|Q7Z4H8|KDEL2_HUMAN KDEL motif-containing protein 2 OS=Homo sapiens GN=KDELC2 PE=1 SV=2 487 609 1.0E-08
sp|Q7ZVE6|KDEL1_DANRE KDEL motif-containing protein 1 OS=Danio rerio GN=kdelc1 PE=2 SV=1 490 609 2.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5K8R6|CXT1_CRYNJ Beta-1,2-xylosyltransferase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CXT1 PE=1 SV=1 43 610 8.0E-45
sp|Q566E5|KDEL2_RAT KDEL motif-containing protein 2 OS=Rattus norvegicus GN=Kdelc2 PE=2 SV=1 487 609 1.0E-09
sp|Q6UW63|KDEL1_HUMAN KDEL motif-containing protein 1 OS=Homo sapiens GN=KDELC1 PE=1 SV=1 490 605 1.0E-09
sp|Q7Z4H8|KDEL2_HUMAN KDEL motif-containing protein 2 OS=Homo sapiens GN=KDELC2 PE=1 SV=2 487 609 1.0E-08
sp|Q7ZVE6|KDEL1_DANRE KDEL motif-containing protein 1 OS=Danio rerio GN=kdelc1 PE=2 SV=1 490 609 2.0E-08
sp|Q9JHP7|KDEL1_MOUSE KDEL motif-containing protein 1 OS=Mus musculus GN=Kdelc1 PE=1 SV=1 490 605 6.0E-08
sp|G3V9D0|PGLT1_RAT Protein O-glucosyltransferase 1 OS=Rattus norvegicus GN=Poglut1 PE=3 SV=1 491 606 7.0E-08
sp|Q5E9Q1|PGLT1_BOVIN Protein O-glucosyltransferase 1 OS=Bos taurus GN=POGLUT1 PE=2 SV=1 491 606 2.0E-07
sp|Q8NBL1|PGLT1_HUMAN Protein O-glucosyltransferase 1 OS=Homo sapiens GN=POGLUT1 PE=1 SV=1 491 606 3.0E-07
sp|Q29AU6|RUMI_DROPS O-glucosyltransferase rumi OS=Drosophila pseudoobscura pseudoobscura GN=rumi PE=3 SV=1 491 606 3.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 40 0.5

Transmembrane Domains

Domain # Start End Length
1 17 39 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2173
MLLPHCLFPSKRRGCKWLLLVLAIFVLLLWPLAFDGALALRRQMKQTATVTTWKPADVDGNHPIDDLIRDANLRF
EALLQKRSTSLAQATQHYLDRRGRRPPPGFDAWYEAAERSNVVVVEDFFDRIHDDIAPFWAVEPRTLRRLARGSE
TVVRVRAGKVVPDPKAAEASHRYRQWEALVAEMAQHLPDLDMPVNTMDESRVLVPWETIDGYVSEERRLRTIVDA
GQAVGSYGPLNDEDEPMEADWIKDQVTEYWSHYAATCPPESPGRNATSPRPLSSPVEFPQRPVAAYTHRGFVYNF
TGSQDACLQPHLNGMHGTFIESISMSTTHQLVPMFGESKLPRNNELLIPAAVYLDDGRLEYSGGADHGGRWAGKR
DGLVWRGVSSGGRNRRDSWRRMQRNRFIQILNGSVVDAVARMDGDGDGGDQHSFRLAADDVYPVQARRRGRLGEW
ISTWADAGFVEALCEPPEEVETIPQPPTRFCRWLRPEFSVASSVPMKDMYDYKFLPDVDGNSFSGRFRALLLSTS
LPLKATIYAEWHDSRLVPWVHFVPMDNSFMDLYAIMDYLMGRDERASRIAADGKTWAEAVLRREDMKLYVWRLLL
EYARVVRDGRHGLAFVGEGEV*
Coding >Ophun1|2173
ATGCTGCTCCCTCACTGCCTGTTCCCGTCCAAGAGGAGAGGATGCAAATGGCTGTTGCTCGTCCTCGCCATCTTC
GTCTTACTGCTCTGGCCCCTCGCCTTCGATGGCGCTCTCGCTCTGCGCCGCCAGATGAAGCAGACGGCGACGGTG
ACGACCTGGAAGCCGGCTGACGTTGATGGAAACCACCCGATAGACGACCTGATCCGTGACGCCAACCTGCGCTTC
GAAGCCCTGCTGCAGAAGCGCTCCACCTCACTCGCTCAGGCGACGCAGCACTATCTCGATCGCCGCGGGAGGAGG
CCACCGCCGGGCTTCGACGCCTGGTATGAGGCTGCTGAGCGGAGCAATGTCGTCGTCGTCGAGGACTTCTTCGAC
CGCATTCACGACGACATTGCCCCCTTTTGGGCCGTTGAGCCCCGGACTTTGCGCCGTCTGGCTCGCGGCTCCGAG
ACCGTCGTCCGCGTCCGGGCCGGAAAGGTGGTGCCTGACCCCAAGGCGGCAGAGGCGTCGCATCGCTACAGGCAG
TGGGAGGCGCTCGTGGCTGAGATGGCGCAACATCTGCCGGATCTCGATATGCCCGTCAACACCATGGACGAGTCG
CGCGTCTTGGTGCCCTGGGAGACCATCGACGGCTACGTGTCGGAGGAGCGTCGGCTGAGGACCATTGTCGACGCC
GGCCAGGCCGTCGGCTCGTACGGGCCCCTGAACGACGAAGATGAGCCCATGGAGGCAGACTGGATCAAGGACCAG
GTAACAGAGTACTGGAGCCACTACGCCGCCACCTGTCCTCCCGAAAGCCCGGGCCGCAACGCCACGTCGCCCAGG
CCGCTGAGCTCGCCCGTCGAATTCCCACAAAGGCCGGTGGCGGCCTACACGCACCGCGGCTTCGTCTACAACTTT
ACTGGGTCGCAAGACGCCTGCCTGCAGCCGCACCTCAACGGTATGCACGGCACCTTTATCGAGAGCATCAGCATG
TCGACGACGCATCAGTTGGTGCCCATGTTTGGCGAGTCCAAGCTGCCGCGCAATAATGAGCTGCTGATACCCGCC
GCCGTCTACCTCGACGACGGACGGCTCGAGTACAGCGGCGGCGCTGATCATGGCGGTCGCTGGGCGGGAAAGAGA
GACGGCCTCGTTTGGAGGGGCGTCTCGTCGGGCGGACGCAACAGGAGGGACAGCTGGCGGCGCATGCAACGGAAT
CGCTTCATCCAGATACTCAACGGGTCCGTCGTCGACGCCGTTGCGCGGATGGATGGCGACGGTGACGGCGGTGAC
CAGCACAGCTTCCGGCTCGCAGCCGACGACGTCTACCCCGTCCAGGCCCGACGTCGGGGCCGGCTCGGCGAGTGG
ATCTCGACCTGGGCCGACGCCGGCTTTGTCGAGGCTCTGTGCGAGCCGCCGGAGGAGGTGGAGACGATCCCGCAA
CCGCCGACGCGCTTCTGCCGGTGGCTACGGCCCGAGTTCTCGGTGGCGTCGAGCGTGCCGATGAAGGACATGTAC
GACTACAAGTTTCTGCCGGACGTGGACGGCAACTCGTTCAGCGGGCGGTTCCGAGCGCTGCTTCTGTCGACGTCG
CTGCCGCTCAAGGCAACCATCTACGCCGAGTGGCACGACAGCCGGCTGGTGCCGTGGGTTCACTTTGTCCCGATG
GACAATAGCTTCATGGACCTGTACGCCATCATGGACTATCTCATGGGGCGGGACGAGCGGGCGAGCCGGATAGCA
GCCGATGGGAAGACGTGGGCTGAGGCGGTATTGCGGAGGGAGGATATGAAGCTTTATGTCTGGCGGTTGCTGTTG
GAGTATGCGCGGGTTGTGAGGGATGGGCGGCATGGGTTGGCGTTTGTGGGCGAGGGTGAGGTGTGA
Transcript >Ophun1|2173
ATGCTGCTCCCTCACTGCCTGTTCCCGTCCAAGAGGAGAGGATGCAAATGGCTGTTGCTCGTCCTCGCCATCTTC
GTCTTACTGCTCTGGCCCCTCGCCTTCGATGGCGCTCTCGCTCTGCGCCGCCAGATGAAGCAGACGGCGACGGTG
ACGACCTGGAAGCCGGCTGACGTTGATGGAAACCACCCGATAGACGACCTGATCCGTGACGCCAACCTGCGCTTC
GAAGCCCTGCTGCAGAAGCGCTCCACCTCACTCGCTCAGGCGACGCAGCACTATCTCGATCGCCGCGGGAGGAGG
CCACCGCCGGGCTTCGACGCCTGGTATGAGGCTGCTGAGCGGAGCAATGTCGTCGTCGTCGAGGACTTCTTCGAC
CGCATTCACGACGACATTGCCCCCTTTTGGGCCGTTGAGCCCCGGACTTTGCGCCGTCTGGCTCGCGGCTCCGAG
ACCGTCGTCCGCGTCCGGGCCGGAAAGGTGGTGCCTGACCCCAAGGCGGCAGAGGCGTCGCATCGCTACAGGCAG
TGGGAGGCGCTCGTGGCTGAGATGGCGCAACATCTGCCGGATCTCGATATGCCCGTCAACACCATGGACGAGTCG
CGCGTCTTGGTGCCCTGGGAGACCATCGACGGCTACGTGTCGGAGGAGCGTCGGCTGAGGACCATTGTCGACGCC
GGCCAGGCCGTCGGCTCGTACGGGCCCCTGAACGACGAAGATGAGCCCATGGAGGCAGACTGGATCAAGGACCAG
GTAACAGAGTACTGGAGCCACTACGCCGCCACCTGTCCTCCCGAAAGCCCGGGCCGCAACGCCACGTCGCCCAGG
CCGCTGAGCTCGCCCGTCGAATTCCCACAAAGGCCGGTGGCGGCCTACACGCACCGCGGCTTCGTCTACAACTTT
ACTGGGTCGCAAGACGCCTGCCTGCAGCCGCACCTCAACGGTATGCACGGCACCTTTATCGAGAGCATCAGCATG
TCGACGACGCATCAGTTGGTGCCCATGTTTGGCGAGTCCAAGCTGCCGCGCAATAATGAGCTGCTGATACCCGCC
GCCGTCTACCTCGACGACGGACGGCTCGAGTACAGCGGCGGCGCTGATCATGGCGGTCGCTGGGCGGGAAAGAGA
GACGGCCTCGTTTGGAGGGGCGTCTCGTCGGGCGGACGCAACAGGAGGGACAGCTGGCGGCGCATGCAACGGAAT
CGCTTCATCCAGATACTCAACGGGTCCGTCGTCGACGCCGTTGCGCGGATGGATGGCGACGGTGACGGCGGTGAC
CAGCACAGCTTCCGGCTCGCAGCCGACGACGTCTACCCCGTCCAGGCCCGACGTCGGGGCCGGCTCGGCGAGTGG
ATCTCGACCTGGGCCGACGCCGGCTTTGTCGAGGCTCTGTGCGAGCCGCCGGAGGAGGTGGAGACGATCCCGCAA
CCGCCGACGCGCTTCTGCCGGTGGCTACGGCCCGAGTTCTCGGTGGCGTCGAGCGTGCCGATGAAGGACATGTAC
GACTACAAGTTTCTGCCGGACGTGGACGGCAACTCGTTCAGCGGGCGGTTCCGAGCGCTGCTTCTGTCGACGTCG
CTGCCGCTCAAGGCAACCATCTACGCCGAGTGGCACGACAGCCGGCTGGTGCCGTGGGTTCACTTTGTCCCGATG
GACAATAGCTTCATGGACCTGTACGCCATCATGGACTATCTCATGGGGCGGGACGAGCGGGCGAGCCGGATAGCA
GCCGATGGGAAGACGTGGGCTGAGGCGGTATTGCGGAGGGAGGATATGAAGCTTTATGTCTGGCGGTTGCTGTTG
GAGTATGCGCGGGTTGTGAGGGATGGGCGGCATGGGTTGGCGTTTGTGGGCGAGGGTGAGGTGTGA
Gene >Ophun1|2173
ATGCTGCTCCCTCACTGCCTGTTCCCGTCCAAGAGGAGAGGATGCAAATGGCTGTTGCTCGTCCTCGCCATCTTC
GTCTTACTGCTCTGGCCCCTCGCCTTCGATGGCGCTCTCGCTCTGCGCCGCCAGATGAAGCAGACGGCGACGGTG
ACGACCTGGAAGCCGGCTGACGTTGATGGAAACCACCCGATAGACGACCTGATCCGTGACGCCAACCTGCGCTTC
GAAGCCCTGCTGCAGAAGCGCTCCACCTCACTCGCTCAGGCGACGCAGCACTATCTCGATCGCCGCGGGAGGAGG
CCACCGCCGGGCTTCGACGCCTGGTATGAGGCTGCTGAGCGGAGCAATGTCGTCGTCGTCGAGGACTTCTTCGAC
CGCATTCACGACGACATTGCCCCCTTTTGGGCCGTTGAGCCCCGGACTTTGCGCCGTCTGGCTCGCGGCTCCGAG
ACCGTCGTCCGCGTCCGGGCCGGAAAGGTGGTGCCTGACCCCAAGGCGGCAGAGGCGTCGCATCGCTACAGGCAG
TGGGAGGCGCTCGTGGCTGAGATGGCGCAACATCTGCCGGATCTCGATATGCCCGTCAACACCATGGACGAGTCG
CGCGTCTTGGTGCCCTGGGAGACCATCGACGGCTACGTGTCGGAGGAGCGTCGGCTGAGGACCATTGTCGACGCC
GGCCAGGCCGTCGGCTCGTACGGGCCCCTGAACGACGAAGATGAGCCCATGGAGGCAGACTGGATCAAGGACCAG
GTAACAGAGTACTGGAGCCACTACGCCGCCACCTGTCCTCCCGAAAGCCCGGGCCGCAACGCCACGTCGCCCAGG
CCGCTGAGCTCGCCCGTCGAATTCCCACAAAGGCCGGTGGCGGCCTACACGCACCGCGGCTTCGTCTACAACTTT
ACTGGGTCGCAAGACGCCTGCCTGCAGCCGCACCTCAACGGTATGCACGGCACCTTTATCGAGAGCATCAGCATG
TCGACGACGCATCAGTTGGTGCCCATGTTTGGCGAGTCCAAGCTGCCGCGCAATAATGAGCTGCTGATACCCGCC
GCCGTCTACCTCGACGACGGACGGCTCGAGTACAGCGGCGGCGCTGATCATGGCGGTCGCTGGGCGGGAAAGAGA
GACGGCCTCGTTTGGAGGGGCGTCTCGTCGGGCGGACGCAACAGGAGGGACAGCTGGCGGCGCATGCAACGGAAT
CGCTTCATCCAGATACTCAACGGGTCCGTCGTCGACGCCGTTGCGCGGATGGATGGCGACGGTGACGGCGGTGAC
CAGCACAGCTTCCGGCTCGCAGCCGACGACGTCTACCCCGTCCAGGCCCGACGTCGGGGCCGGCTCGGCGAGTGG
ATCTCGACCTGGGCCGACGCCGGCTTTGTCGAGGCTCTGTGCGAGCCGCCGGAGGAGGTGGAGACGATCCCGCAA
CCGCCGACGCGCTTCTGCCGGTGGCTACGGCCCGAGTTCTCGGTGGCGTCGAGCGTGCCGATGAAGGACATGTAC
GACTACAAGTTTCTGCCGGACGTGGACGGCAACTCGTTCAGCGGGCGGTTCCGAGCGCTGCTTCTGTCGACGTCG
CTGCCGCTCAAGGCAACCATCTACGCCGAGTGGCACGACAGCCGGCTGGTGCCGTGGGTTCACTTTGTCCCGATG
GACAATAGCTTCATGGACCTGTACGCCATCATGGACTATCTCATGGGGCGGGACGAGCGGGCGAGCCGGATAGCA
GCCGATGGGAAGACGTGGGCTGAGGCGGTATTGCGGAGGGAGGATATGAAGCTTTATGTCTGGCGGTTGCTGTTG
GAGTATGCGCGGGTTGTGAGGGATGGGCGGCATGGGTTGGCGTTTGTGGGCGAGGGTGAGGTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail