Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2168
Gene name
LocationContig_201:20459..21464
Strand-
Gene length (bp)1005
Transcript length (bp)1005
Coding sequence length (bp)1005
Protein length (aa) 335

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04488 Gly_transf_sug Glycosyltransferase sugar-binding region containing DXD motif 1.7E-10 103 156

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q10323|IMT3_SCHPO Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC17G8.11c PE=1 SV=1 57 277 4.0E-23
sp|O14084|IMT1_SCHPO Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=imt1 PE=3 SV=2 62 271 5.0E-19
sp|Q9UT67|IMT2_SCHPO Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC4F11.04c PE=3 SV=1 23 323 2.0E-18
sp|P38287|CSH1_YEAST Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CSH1 PE=1 SV=1 62 281 2.0E-16
sp|P33300|SUR1_YEAST Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SUR1 PE=1 SV=1 62 281 6.0E-15

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 27 0.45

Transmembrane Domains

Domain # Start End Length
1 13 32 19
2 281 303 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2168
MAPLMRWSSRKAAALVFLSLVLLLVGHQVSYISDIDLANRLPDSLQVVSQCSATSQDDNAGIPKRIHQIWKTSNV
SSYPIEATHAAWKSMFEPADYTVKLWAEADIVNLIAAKYPWLLSTYQGYSQNIQRADVARLVVLHAEGGIYADLD
VHPISPQELSCWRHLGLQALFAPTSGTQGISNHFVMADKGAAFLQWALHEAKRRGGASSRRIIFPYLQVFWSTGP
LMVNSAYRSYVSHMGQADKPVGVAEERYGGSVVRHAAGRSWHKSDGLFLNYVADRVGVGSSYIVIVAPVLILALA
AILARRYFKAGMLASRDGPLSPIIDRIQAFKDRP*
Coding >Ophun1|2168
ATGGCCCCCCTAATGAGATGGAGTTCCCGCAAAGCCGCCGCCCTCGTCTTCCTCTCCCTCGTCCTCCTCCTCGTC
GGCCATCAGGTCAGCTACATAAGCGACATTGACCTCGCCAACCGCCTCCCCGACTCCCTACAAGTCGTCAGCCAG
TGCTCAGCCACGAGCCAAGATGACAACGCCGGAATCCCCAAGCGTATCCATCAGATCTGGAAGACGAGCAACGTC
TCGTCATACCCCATCGAGGCCACCCACGCTGCCTGGAAGTCCATGTTTGAACCGGCAGACTACACCGTCAAGCTC
TGGGCCGAAGCCGACATCGTCAACCTGATAGCAGCAAAGTACCCCTGGCTCCTATCGACATACCAGGGCTACTCG
CAGAACATCCAACGCGCAGACGTCGCCAGGCTCGTCGTCCTCCACGCTGAAGGCGGCATCTACGCTGATCTCGAC
GTCCATCCCATCTCGCCACAAGAACTCTCCTGCTGGCGTCATCTCGGGCTTCAGGCTCTCTTCGCCCCGACTTCC
GGAACGCAGGGCATCAGCAACCACTTCGTCATGGCCGACAAGGGCGCCGCCTTTCTCCAATGGGCACTGCACGAG
GCCAAGCGCCGAGGAGGAGCCTCGTCTCGACGAATCATCTTCCCCTATCTACAGGTCTTTTGGTCGACGGGGCCT
CTCATGGTCAACTCGGCTTACCGCTCCTACGTCTCGCACATGGGTCAGGCAGATAAGCCGGTGGGCGTGGCCGAG
GAGAGATATGGAGGATCCGTCGTCCGTCACGCTGCAGGCCGATCATGGCACAAGTCTGACGGCCTGTTCCTGAAC
TACGTTGCCGACAGGGTGGGCGTGGGCAGTTCCTACATTGTCATTGTTGCCCCGGTGCTTATCCTCGCCCTGGCG
GCGATCCTGGCGAGACGGTACTTCAAGGCCGGCATGTTGGCTTCGCGTGATGGACCGCTGTCTCCCATAATCGAC
CGGATACAAGCCTTCAAGGATAGACCGTGA
Transcript >Ophun1|2168
ATGGCCCCCCTAATGAGATGGAGTTCCCGCAAAGCCGCCGCCCTCGTCTTCCTCTCCCTCGTCCTCCTCCTCGTC
GGCCATCAGGTCAGCTACATAAGCGACATTGACCTCGCCAACCGCCTCCCCGACTCCCTACAAGTCGTCAGCCAG
TGCTCAGCCACGAGCCAAGATGACAACGCCGGAATCCCCAAGCGTATCCATCAGATCTGGAAGACGAGCAACGTC
TCGTCATACCCCATCGAGGCCACCCACGCTGCCTGGAAGTCCATGTTTGAACCGGCAGACTACACCGTCAAGCTC
TGGGCCGAAGCCGACATCGTCAACCTGATAGCAGCAAAGTACCCCTGGCTCCTATCGACATACCAGGGCTACTCG
CAGAACATCCAACGCGCAGACGTCGCCAGGCTCGTCGTCCTCCACGCTGAAGGCGGCATCTACGCTGATCTCGAC
GTCCATCCCATCTCGCCACAAGAACTCTCCTGCTGGCGTCATCTCGGGCTTCAGGCTCTCTTCGCCCCGACTTCC
GGAACGCAGGGCATCAGCAACCACTTCGTCATGGCCGACAAGGGCGCCGCCTTTCTCCAATGGGCACTGCACGAG
GCCAAGCGCCGAGGAGGAGCCTCGTCTCGACGAATCATCTTCCCCTATCTACAGGTCTTTTGGTCGACGGGGCCT
CTCATGGTCAACTCGGCTTACCGCTCCTACGTCTCGCACATGGGTCAGGCAGATAAGCCGGTGGGCGTGGCCGAG
GAGAGATATGGAGGATCCGTCGTCCGTCACGCTGCAGGCCGATCATGGCACAAGTCTGACGGCCTGTTCCTGAAC
TACGTTGCCGACAGGGTGGGCGTGGGCAGTTCCTACATTGTCATTGTTGCCCCGGTGCTTATCCTCGCCCTGGCG
GCGATCCTGGCGAGACGGTACTTCAAGGCCGGCATGTTGGCTTCGCGTGATGGACCGCTGTCTCCCATAATCGAC
CGGATACAAGCCTTCAAGGATAGACCGTGA
Gene >Ophun1|2168
ATGGCCCCCCTAATGAGATGGAGTTCCCGCAAAGCCGCCGCCCTCGTCTTCCTCTCCCTCGTCCTCCTCCTCGTC
GGCCATCAGGTCAGCTACATAAGCGACATTGACCTCGCCAACCGCCTCCCCGACTCCCTACAAGTCGTCAGCCAG
TGCTCAGCCACGAGCCAAGATGACAACGCCGGAATCCCCAAGCGTATCCATCAGATCTGGAAGACGAGCAACGTC
TCGTCATACCCCATCGAGGCCACCCACGCTGCCTGGAAGTCCATGTTTGAACCGGCAGACTACACCGTCAAGCTC
TGGGCCGAAGCCGACATCGTCAACCTGATAGCAGCAAAGTACCCCTGGCTCCTATCGACATACCAGGGCTACTCG
CAGAACATCCAACGCGCAGACGTCGCCAGGCTCGTCGTCCTCCACGCTGAAGGCGGCATCTACGCTGATCTCGAC
GTCCATCCCATCTCGCCACAAGAACTCTCCTGCTGGCGTCATCTCGGGCTTCAGGCTCTCTTCGCCCCGACTTCC
GGAACGCAGGGCATCAGCAACCACTTCGTCATGGCCGACAAGGGCGCCGCCTTTCTCCAATGGGCACTGCACGAG
GCCAAGCGCCGAGGAGGAGCCTCGTCTCGACGAATCATCTTCCCCTATCTACAGGTCTTTTGGTCGACGGGGCCT
CTCATGGTCAACTCGGCTTACCGCTCCTACGTCTCGCACATGGGTCAGGCAGATAAGCCGGTGGGCGTGGCCGAG
GAGAGATATGGAGGATCCGTCGTCCGTCACGCTGCAGGCCGATCATGGCACAAGTCTGACGGCCTGTTCCTGAAC
TACGTTGCCGACAGGGTGGGCGTGGGCAGTTCCTACATTGTCATTGTTGCCCCGGTGCTTATCCTCGCCCTGGCG
GCGATCCTGGCGAGACGGTACTTCAAGGCCGGCATGTTGGCTTCGCGTGATGGACCGCTGTCTCCCATAATCGAC
CGGATACAAGCCTTCAAGGATAGACCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail