Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2163
Gene name
LocationContig_201:7968..12925
Strand+
Gene length (bp)4957
Transcript length (bp)3834
Coding sequence length (bp)3834
Protein length (aa) 1278

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02714 RSN1_7TM Calcium-dependent channel, 7TM region, putative phosphate 3.0E-73 514 785
PF13967 RSN1_TM Late exocytosis, associated with Golgi transport 6.1E-44 60 208
PF01138 RNase_PH 3' exoribonuclease family, domain 1 2.0E-32 1065 1198
PF14703 PHM7_cyt Cytosolic domain of 10TM putative phosphate transporter 1.5E-23 231 502
PF12621 PHM7_ext Extracellular tail, of 10TM putative phosphate transporter 1.1E-19 960 1040

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q03516|RSN1_YEAST Uncharacterized protein RSN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSN1 PE=1 SV=1 406 1018 8.0E-92
sp|Q09766|YA7D_SCHPO Uncharacterized membrane protein C24H6.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC24H6.13 PE=1 SV=1 411 898 6.0E-81
sp|Q12252|PHM7_YEAST Phosphate metabolism protein 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHM7 PE=1 SV=1 408 823 9.0E-73
sp|O42872|RRP41_SCHPO Exosome complex component ski6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ski6 PE=2 SV=1 1051 1272 3.0E-44
sp|P46948|RRP41_YEAST Exosome complex component SKI6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SKI6 PE=1 SV=1 1050 1277 2.0E-38
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q03516|RSN1_YEAST Uncharacterized protein RSN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSN1 PE=1 SV=1 406 1018 8.0E-92
sp|Q09766|YA7D_SCHPO Uncharacterized membrane protein C24H6.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC24H6.13 PE=1 SV=1 411 898 6.0E-81
sp|Q12252|PHM7_YEAST Phosphate metabolism protein 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHM7 PE=1 SV=1 408 823 9.0E-73
sp|O42872|RRP41_SCHPO Exosome complex component ski6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ski6 PE=2 SV=1 1051 1272 3.0E-44
sp|P46948|RRP41_YEAST Exosome complex component SKI6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SKI6 PE=1 SV=1 1050 1277 2.0E-38
sp|Q03516|RSN1_YEAST Uncharacterized protein RSN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSN1 PE=1 SV=1 71 289 3.0E-38
sp|Q12252|PHM7_YEAST Phosphate metabolism protein 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHM7 PE=1 SV=1 54 308 5.0E-35
sp|Q09766|YA7D_SCHPO Uncharacterized membrane protein C24H6.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC24H6.13 PE=1 SV=1 67 309 9.0E-34
sp|Q9SP08|RRP41_ARATH Exosome complex component RRP41 homolog OS=Arabidopsis thaliana GN=RRP41 PE=1 SV=1 1055 1273 9.0E-34
sp|Q07798|SPO75_YEAST Sporulation-specific protein 75 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPO75 PE=1 SV=1 417 881 1.0E-33
sp|A8WQQ5|EXOS4_CAEBR Putative exosome complex component RRP41 OS=Caenorhabditis briggsae GN=exos-4.1 PE=3 SV=1 1055 1274 4.0E-31
sp|Q17533|EXOS4_CAEEL Putative exosome complex component RRP41 OS=Caenorhabditis elegans GN=exos-4.1 PE=3 SV=2 1055 1274 4.0E-31
sp|Q921I9|EXOS4_MOUSE Exosome complex component RRP41 OS=Mus musculus GN=Exosc4 PE=1 SV=3 1056 1266 5.0E-30
sp|Q7YRA3|EXOS4_BOVIN Exosome complex component RRP41 OS=Bos taurus GN=EXOSC4 PE=2 SV=3 1056 1266 7.0E-30
sp|Q9NPD3|EXOS4_HUMAN Exosome complex component RRP41 OS=Homo sapiens GN=EXOSC4 PE=1 SV=3 1056 1266 9.0E-30
sp|Q9FVQ5|CSCL1_ARATH CSC1-like protein At1g32090 OS=Arabidopsis thaliana GN=At1g32090 PE=1 SV=1 420 786 1.0E-28
sp|Q9HIP2|RRP41_THEAC Exosome complex component Rrp41 OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=rrp41 PE=3 SV=1 1055 1244 9.0E-24
sp|Q9SY14|CSCL2_ARATH CSC1-like protein At4g02900 OS=Arabidopsis thaliana GN=At4g02900 PE=3 SV=1 412 786 9.0E-24
sp|Q97BZ5|RRP41_THEVO Exosome complex component Rrp41 OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=rrp41 PE=3 SV=1 1055 1244 2.0E-23
sp|A9LIW2|CSC1L_BRAJU CSC1-like protein ERD4 OS=Brassica juncea GN=ERD4 PE=3 SV=2 413 807 4.0E-23
sp|Q9C8G5|CSCLD_ARATH CSC1-like protein ERD4 OS=Arabidopsis thaliana GN=ERD4 PE=2 SV=1 412 807 2.0E-22
sp|B5TYT3|CSCL7_ARATH CSC1-like protein At1g11960 OS=Arabidopsis thaliana GN=At1g11960 PE=2 SV=1 417 808 2.0E-22
sp|Q9LVE4|CSCL4_ARATH CSC1-like protein At3g21620 OS=Arabidopsis thaliana GN=At3g21620 PE=2 SV=1 415 808 5.0E-22
sp|Q8VZM5|CSCL3_ARATH CSC1-like protein At4g15430 OS=Arabidopsis thaliana GN=At4g15430 PE=2 SV=1 420 786 2.0E-21
sp|Q06538|CSC1_YEAST Calcium permeable stress-gated cation channel 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CSC1 PE=1 SV=1 72 786 3.0E-21
sp|Q5XEZ5|CSC1_ARATH Calcium permeable stress-gated cation channel 1 OS=Arabidopsis thaliana GN=CSC1 PE=2 SV=1 420 784 6.0E-21
sp|O26779|RRP41_METTH Exosome complex component Rrp41 OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=rrp41 PE=1 SV=1 1055 1273 7.0E-21
sp|F4JCY2|CSCL8_ARATH CSC1-like protein At3g54510 OS=Arabidopsis thaliana GN=At3g54510 PE=2 SV=1 420 841 2.0E-20
sp|F4HYR3|CSCL6_ARATH CSC1-like protein At1g62320 OS=Arabidopsis thaliana GN=At1g62320 PE=3 SV=2 420 808 4.0E-20
sp|Q5JIR6|RRP41_THEKO Exosome complex component Rrp41 OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=rrp41 PE=3 SV=1 1056 1231 5.0E-20
sp|C5A2B9|RRP41_THEGJ Exosome complex component Rrp41 OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=rrp41 PE=3 SV=1 1056 1231 5.0E-20
sp|O29757|RRP41_ARCFU Exosome complex component Rrp41 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=rrp41 PE=1 SV=1 1055 1257 6.0E-20
sp|Q09809|CSC1_SCHPO Calcium permeable stress-gated cation channel 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC2G11.09 PE=3 SV=2 420 804 3.0E-19
sp|Q9XEA1|CSCL5_ARATH Protein OSCA1 OS=Arabidopsis thaliana GN=OSCA1 PE=1 SV=1 420 784 7.0E-19
sp|B6YSI2|RRP41_THEON Exosome complex component Rrp41 OS=Thermococcus onnurineus (strain NA1) GN=rrp41 PE=3 SV=1 1056 1231 3.0E-18
sp|O59223|RRP41_PYRHO Exosome complex component Rrp41 OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=rrp41 PE=3 SV=1 1056 1231 3.0E-18
sp|Q8TYC1|RRP41_METKA Exosome complex component Rrp41 OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=rrp41 PE=3 SV=1 1055 1275 5.0E-18
sp|Q8U0L9|RRP41_PYRFU Exosome complex component Rrp41 OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=rrp41 PE=3 SV=1 1056 1231 8.0E-18
sp|Q9V119|RRP41_PYRAB Exosome complex component Rrp41 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=rrp41 PE=1 SV=1 1056 1231 1.0E-17
sp|Q8PTT8|RRP41_METMA Exosome complex component Rrp41 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=rrp41 PE=3 SV=1 1044 1266 3.0E-16
sp|Q4JB27|RRP41_SULAC Exosome complex component Rrp41 OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=rrp41 PE=3 SV=1 1055 1244 8.0E-16
sp|Q6P0I8|EXOS6_DANRE Exosome complex component MTR3 OS=Danio rerio GN=exosc6 PE=2 SV=2 1059 1207 1.0E-15
sp|Q975G8|RRP41_SULTO Exosome complex component Rrp41 OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=rrp41 PE=3 SV=2 1055 1232 1.0E-15
sp|Q9UXC2|RRP41_SULSO Exosome complex component Rrp41 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=rrp41 PE=1 SV=1 1056 1232 5.0E-15
sp|A9A5C9|RRP41_NITMS Exosome complex component Rrp41 OS=Nitrosopumilus maritimus (strain SCM1) GN=rrp41 PE=3 SV=1 1056 1275 2.0E-14
sp|Q94A87|CSCL9_ARATH CSC1-like protein At1g10090 OS=Arabidopsis thaliana GN=At1g10090 PE=1 SV=1 460 894 3.0E-14
sp|F4IBD7|CSCLA_ARATH CSC1-like protein RXW8 OS=Arabidopsis thaliana GN=RXW8 PE=2 SV=1 461 790 7.0E-14
sp|Q84T68|EXOS5_ORYSJ Exosome complex exonuclease RRP46 homolog OS=Oryza sativa subsp. japonica GN=RRP46 PE=1 SV=2 1056 1234 3.0E-13
sp|Q9YC03|RRP41_AERPE Exosome complex component Rrp41 OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=rrp41 PE=3 SV=1 1056 1244 1.0E-12
sp|Q8GUH7|CSCLC_ARATH CSC1-like protein HYP1 OS=Arabidopsis thaliana GN=HYP1 PE=2 SV=1 420 852 5.0E-12
sp|B0K3T4|RNPH_THEPX Ribonuclease PH OS=Thermoanaerobacter sp. (strain X514) GN=rph PE=3 SV=1 1056 1245 5.0E-12
sp|B0KBM5|RNPH_THEP3 Ribonuclease PH OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=rph PE=3 SV=1 1056 1245 5.0E-12
sp|Q8RC30|RNPH_CALS4 Ribonuclease PH OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=rph PE=3 SV=1 1056 1245 7.0E-12
sp|A2BKC0|RRP41_HYPBU Exosome complex component Rrp41 OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) GN=rrp41 PE=3 SV=1 1055 1232 8.0E-12
sp|Q9LX74|EXOS5_ARATH Exosome complex exonuclease RRP46 homolog OS=Arabidopsis thaliana GN=RRP46 PE=2 SV=1 1052 1249 1.0E-11
sp|B1Y978|RRP41_PYRNV Exosome complex component Rrp41 OS=Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / V24Sta) GN=rrp41 PE=3 SV=1 1055 1246 4.0E-10
sp|A1RST0|RRP41_PYRIL Exosome complex component Rrp41 OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=rrp41 PE=3 SV=1 1055 1246 5.0E-10
sp|F4I248|CSCLB_ARATH CSC1-like protein At1g69450 OS=Arabidopsis thaliana GN=At1g69450 PE=2 SV=1 419 873 1.0E-09
sp|A3MUP1|RRP41_PYRCJ Exosome complex component Rrp41 OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=rrp41 PE=3 SV=1 1055 1246 2.0E-09
sp|Q9CRA8|EXOS5_MOUSE Exosome complex component RRP46 OS=Mus musculus GN=Exosc5 PE=1 SV=1 1079 1233 3.0E-09
sp|Q9NQT4|EXOS5_HUMAN Exosome complex component RRP46 OS=Homo sapiens GN=EXOSC5 PE=1 SV=1 1079 1233 9.0E-09
sp|A0RXU1|RRP41_CENSY Exosome complex component Rrp41 OS=Cenarchaeum symbiosum (strain A) GN=rrp41 PE=3 SV=1 1055 1268 1.0E-08
sp|Q28F19|EXOS6_XENTR Exosome complex component MTR3 OS=Xenopus tropicalis GN=exosc6 PE=2 SV=1 1059 1221 2.0E-08
sp|Q6FFX5|RNPH_ACIAD Ribonuclease PH OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=rph PE=3 SV=2 1055 1195 3.0E-08
sp|A5N2V9|RNPH_CLOK5 Ribonuclease PH OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=rph PE=3 SV=1 1055 1244 4.0E-08
sp|B9DWL2|RNPH_CLOK1 Ribonuclease PH OS=Clostridium kluyveri (strain NBRC 12016) GN=rph PE=3 SV=1 1055 1244 4.0E-08
sp|A4XI64|RNPH_CALS8 Ribonuclease PH OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=rph PE=3 SV=1 1055 1260 4.0E-08
sp|B8I1A8|RNPH_CLOCE Ribonuclease PH OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=rph PE=3 SV=1 1054 1244 4.0E-08
sp|Q8BTW3|EXOS6_MOUSE Exosome complex component MTR3 OS=Mus musculus GN=Exosc6 PE=1 SV=1 1065 1273 7.0E-08
sp|C0ZAF8|RNPH_BREBN Ribonuclease PH OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=rph PE=3 SV=1 1055 1244 8.0E-08
sp|Q8ZVM9|RRP41_PYRAE Exosome complex component Rrp41 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=rrp41 PE=3 SV=1 1055 1246 8.0E-08
sp|Q8EPJ5|RNPH_OCEIH Ribonuclease PH OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=rph PE=3 SV=1 1055 1272 8.0E-08
sp|A5WHJ0|RNPH_PSYWF Ribonuclease PH OS=Psychrobacter sp. (strain PRwf-1) GN=rph PE=3 SV=1 1055 1231 9.0E-08
sp|B7GH12|RNPH_ANOFW Ribonuclease PH OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=rph PE=3 SV=1 1055 1244 9.0E-08
sp|Q1Q8S2|RNPH_PSYCK Ribonuclease PH OS=Psychrobacter cryohalolentis (strain K5) GN=rph PE=3 SV=1 1055 1231 1.0E-07
sp|Q4FQJ5|RNPH_PSYA2 Ribonuclease PH OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=rph PE=3 SV=1 1055 1231 1.0E-07
sp|A8L766|RNPH_FRASN Ribonuclease PH OS=Frankia sp. (strain EAN1pec) GN=rph PE=3 SV=1 1054 1245 1.0E-07
sp|B1I4W9|RNPH_DESAP Ribonuclease PH OS=Desulforudis audaxviator (strain MP104C) GN=rph PE=3 SV=1 1054 1262 1.0E-07
sp|A4J7Y7|RNPH_DESRM Ribonuclease PH OS=Desulfotomaculum reducens (strain MI-1) GN=rph PE=3 SV=1 1056 1271 1.0E-07
sp|P37939|RNPH_MYCLE Ribonuclease PH OS=Mycobacterium leprae (strain TN) GN=rph PE=3 SV=1 1056 1245 2.0E-07
sp|B8ZR59|RNPH_MYCLB Ribonuclease PH OS=Mycobacterium leprae (strain Br4923) GN=rph PE=3 SV=1 1056 1245 2.0E-07
sp|O43022|YGV8_SCHPO Uncharacterized protein C354.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC354.08c PE=3 SV=1 105 332 2.0E-07
sp|A4WM67|RRP41_PYRAR Exosome complex component Rrp41 OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=rrp41 PE=3 SV=1 1055 1201 3.0E-07
sp|B2V890|RNPH_SULSY Ribonuclease PH OS=Sulfurihydrogenibium sp. (strain YO3AOP1) GN=rph PE=3 SV=1 1055 1244 3.0E-07
sp|C0QTN9|RNPH_PERMH Ribonuclease PH OS=Persephonella marina (strain DSM 14350 / EX-H1) GN=rph PE=3 SV=1 1055 1244 4.0E-07
sp|Q2JEN8|RNPH_FRASC Ribonuclease PH OS=Frankia sp. (strain CcI3) GN=rph PE=3 SV=1 1054 1195 4.0E-07
sp|P0CG18|RNPH_ECOBW Ribonuclease PH OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=rph PE=1 SV=1 1055 1246 5.0E-07
sp|Q3AFA0|RNPH_CARHZ Ribonuclease PH OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=rph PE=3 SV=1 1055 1244 5.0E-07
sp|B1VVV6|RNPH_STRGG Ribonuclease PH OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=rph PE=3 SV=1 1054 1269 7.0E-07
sp|B9MQJ8|RNPH_CALBD Ribonuclease PH OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=rph PE=3 SV=1 1055 1245 7.0E-07
sp|B0V5W8|RNPH_ACIBY Ribonuclease PH OS=Acinetobacter baumannii (strain AYE) GN=rph PE=3 SV=1 1055 1195 7.0E-07
sp|A3M0U3|RNPH_ACIBT Ribonuclease PH OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=rph PE=3 SV=2 1055 1195 7.0E-07
sp|B0VMP4|RNPH_ACIBS Ribonuclease PH OS=Acinetobacter baumannii (strain SDF) GN=rph PE=3 SV=1 1055 1195 7.0E-07
sp|B2I029|RNPH_ACIBC Ribonuclease PH OS=Acinetobacter baumannii (strain ACICU) GN=rph PE=3 SV=1 1055 1195 7.0E-07
sp|B7IBN8|RNPH_ACIB5 Ribonuclease PH OS=Acinetobacter baumannii (strain AB0057) GN=rph PE=3 SV=1 1055 1195 7.0E-07
sp|B7H2J6|RNPH_ACIB3 Ribonuclease PH OS=Acinetobacter baumannii (strain AB307-0294) GN=rph PE=3 SV=1 1055 1195 7.0E-07
sp|B7IIZ1|RNPH_BACC2 Ribonuclease PH OS=Bacillus cereus (strain G9842) GN=rph PE=3 SV=1 1055 1244 9.0E-07
sp|Q817P3|RNPH_BACCR Ribonuclease PH OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=rph PE=3 SV=1 1055 1244 1.0E-06
sp|B9IZ73|RNPH_BACCQ Ribonuclease PH OS=Bacillus cereus (strain Q1) GN=rph PE=3 SV=1 1055 1244 1.0E-06
sp|B7HQP4|RNPH_BACC7 Ribonuclease PH OS=Bacillus cereus (strain AH187) GN=rph PE=3 SV=1 1055 1244 1.0E-06
sp|Q72ZT1|RNPH_BACC1 Ribonuclease PH OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=rph PE=3 SV=1 1055 1244 1.0E-06
sp|B2TJ05|RNPH_CLOBB Ribonuclease PH OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=rph PE=3 SV=1 1055 1244 1.0E-06
sp|Q6HD42|RNPH_BACHK Ribonuclease PH OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=rph PE=3 SV=1 1055 1244 1.0E-06
sp|Q633V4|RNPH_BACCZ Ribonuclease PH OS=Bacillus cereus (strain ZK / E33L) GN=rph PE=3 SV=1 1055 1244 1.0E-06
sp|C1ETS9|RNPH_BACC3 Ribonuclease PH OS=Bacillus cereus (strain 03BB102) GN=rph PE=3 SV=1 1055 1244 1.0E-06
sp|B7JQ74|RNPH_BACC0 Ribonuclease PH OS=Bacillus cereus (strain AH820) GN=rph PE=3 SV=1 1055 1244 1.0E-06
sp|Q81LA9|RNPH_BACAN Ribonuclease PH OS=Bacillus anthracis GN=rph PE=1 SV=1 1055 1244 1.0E-06
sp|C3L7T5|RNPH_BACAC Ribonuclease PH OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=rph PE=3 SV=1 1055 1244 1.0E-06
sp|C3PA74|RNPH_BACAA Ribonuclease PH OS=Bacillus anthracis (strain A0248) GN=rph PE=3 SV=1 1055 1244 1.0E-06
sp|B2UZ31|RNPH_CLOBA Ribonuclease PH OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=rph PE=3 SV=1 1055 1244 1.0E-06
sp|C5D5M7|RNPH_GEOSW Ribonuclease PH OS=Geobacillus sp. (strain WCH70) GN=rph PE=3 SV=1 1055 1270 1.0E-06
sp|Q329L3|RNPH_SHIDS Ribonuclease PH OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=rph PE=3 SV=1 1055 1246 1.0E-06
sp|A7GTG6|RNPH_BACCN Ribonuclease PH OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=rph PE=3 SV=1 1055 1244 1.0E-06
sp|B1YUN3|RNPH_BURA4 Ribonuclease PH OS=Burkholderia ambifaria (strain MC40-6) GN=rph PE=3 SV=1 1051 1270 1.0E-06
sp|Q0BHF7|RNPH_BURCM Ribonuclease PH OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=rph PE=3 SV=1 1051 1270 1.0E-06
sp|B5TYT3|CSCL7_ARATH CSC1-like protein At1g11960 OS=Arabidopsis thaliana GN=At1g11960 PE=2 SV=1 72 289 2.0E-06
sp|A4JCC2|RNPH_BURVG Ribonuclease PH OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=rph PE=3 SV=1 1051 1270 2.0E-06
sp|Q5RKV6|EXOS6_HUMAN Exosome complex component MTR3 OS=Homo sapiens GN=EXOSC6 PE=1 SV=1 1065 1240 2.0E-06
sp|Q0TBG6|RNPH_ECOL5 Ribonuclease PH OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=rph PE=3 SV=1 1055 1246 2.0E-06
sp|B7UM50|RNPH_ECO27 Ribonuclease PH OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=rph PE=3 SV=1 1055 1246 2.0E-06
sp|Q3YW05|RNPH_SHISS Ribonuclease PH OS=Shigella sonnei (strain Ss046) GN=rph PE=3 SV=1 1055 1246 2.0E-06
sp|Q31UY3|RNPH_SHIBS Ribonuclease PH OS=Shigella boydii serotype 4 (strain Sb227) GN=rph PE=3 SV=1 1055 1246 2.0E-06
sp|B2TTV7|RNPH_SHIB3 Ribonuclease PH OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=rph PE=3 SV=1 1055 1246 2.0E-06
sp|B1LK80|RNPH_ECOSM Ribonuclease PH OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=rph PE=3 SV=1 1055 1246 2.0E-06
sp|B6I3M0|RNPH_ECOSE Ribonuclease PH OS=Escherichia coli (strain SE11) GN=rph PE=3 SV=1 1055 1246 2.0E-06
sp|P66679|RNPH_ECOL6 Ribonuclease PH OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=rph PE=3 SV=1 1055 1246 2.0E-06
sp|A1AHH4|RNPH_ECOK1 Ribonuclease PH OS=Escherichia coli O1:K1 / APEC GN=rph PE=3 SV=1 1055 1246 2.0E-06
sp|B5YWE1|RNPH_ECO5E Ribonuclease PH OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=rph PE=3 SV=1 1055 1246 2.0E-06
sp|P66680|RNPH_ECO57 Ribonuclease PH OS=Escherichia coli O157:H7 GN=rph PE=3 SV=1 1055 1246 2.0E-06
sp|A7ZTJ4|RNPH_ECO24 Ribonuclease PH OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=rph PE=3 SV=1 1055 1246 2.0E-06
sp|C1DI48|RNPH_AZOVD Ribonuclease PH OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=rph PE=3 SV=1 1054 1246 2.0E-06
sp|B8E0G7|RNPH_DICTD Ribonuclease PH OS=Dictyoglomus turgidum (strain Z-1310 / DSM 6724) GN=rph PE=3 SV=1 1054 1232 2.0E-06
sp|Q8FMU8|RNPH_COREF Ribonuclease PH OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=rph PE=3 SV=1 1051 1273 2.0E-06
sp|B7HEB3|RNPH_BACC4 Ribonuclease PH OS=Bacillus cereus (strain B4264) GN=rph PE=3 SV=1 1055 1244 2.0E-06
sp|Q8G7I0|RNPH_BIFLO Ribonuclease PH OS=Bifidobacterium longum (strain NCC 2705) GN=rph PE=3 SV=2 1054 1245 3.0E-06
sp|P0A2C3|RNPH_SALTY Ribonuclease PH OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=rph PE=3 SV=1 1055 1246 3.0E-06
sp|P0A2C4|RNPH_SALTI Ribonuclease PH OS=Salmonella typhi GN=rph PE=3 SV=1 1055 1246 3.0E-06
sp|B4TZY4|RNPH_SALSV Ribonuclease PH OS=Salmonella schwarzengrund (strain CVM19633) GN=rph PE=3 SV=1 1055 1246 3.0E-06
sp|B5BI17|RNPH_SALPK Ribonuclease PH OS=Salmonella paratyphi A (strain AKU_12601) GN=rph PE=3 SV=1 1055 1246 3.0E-06
sp|Q5PC25|RNPH_SALPA Ribonuclease PH OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=rph PE=3 SV=1 1055 1246 3.0E-06
sp|B4SXE4|RNPH_SALNS Ribonuclease PH OS=Salmonella newport (strain SL254) GN=rph PE=3 SV=1 1055 1246 3.0E-06
sp|B4T9Y6|RNPH_SALHS Ribonuclease PH OS=Salmonella heidelberg (strain SL476) GN=rph PE=3 SV=1 1055 1246 3.0E-06
sp|B5R5G7|RNPH_SALEP Ribonuclease PH OS=Salmonella enteritidis PT4 (strain P125109) GN=rph PE=3 SV=1 1055 1246 3.0E-06
sp|B5FM66|RNPH_SALDC Ribonuclease PH OS=Salmonella dublin (strain CT_02021853) GN=rph PE=3 SV=1 1055 1246 3.0E-06
sp|A9MKN2|RNPH_SALAR Ribonuclease PH OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=rph PE=3 SV=1 1055 1246 3.0E-06
sp|B5EXE7|RNPH_SALA4 Ribonuclease PH OS=Salmonella agona (strain SL483) GN=rph PE=3 SV=1 1055 1246 3.0E-06
sp|Q5KWI5|RNPH_GEOKA Ribonuclease PH OS=Geobacillus kaustophilus (strain HTA426) GN=rph PE=3 SV=2 1055 1244 3.0E-06
sp|A6VEE1|RNPH_PSEA7 Ribonuclease PH OS=Pseudomonas aeruginosa (strain PA7) GN=rph PE=3 SV=1 1056 1245 3.0E-06
sp|Q6KAI0|PNP2_ORYSJ Polyribonucleotide nucleotidyltransferase 2, mitochondrial OS=Oryza sativa subsp. japonica GN=PNP2 PE=2 SV=1 1055 1218 4.0E-06
sp|P50597|RNPH_PSEAE Ribonuclease PH OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=rph PE=1 SV=2 1056 1245 4.0E-06
sp|Q02E28|RNPH_PSEAB Ribonuclease PH OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=rph PE=3 SV=1 1056 1245 4.0E-06
sp|B7V5M5|RNPH_PSEA8 Ribonuclease PH OS=Pseudomonas aeruginosa (strain LESB58) GN=rph PE=3 SV=1 1056 1245 4.0E-06
sp|Q57I99|RNPH_SALCH Ribonuclease PH OS=Salmonella choleraesuis (strain SC-B67) GN=rph PE=3 SV=1 1055 1246 4.0E-06
sp|Q9S7G6|PNP2_ARATH Polyribonucleotide nucleotidyltransferase 2, mitochondrial OS=Arabidopsis thaliana GN=PNP2 PE=2 SV=1 1055 1222 4.0E-06
sp|A5G3S1|RNPH_GEOUR Ribonuclease PH OS=Geobacter uraniireducens (strain Rf4) GN=rph PE=3 SV=1 1055 1241 5.0E-06
sp|A1KCM3|RNPH_AZOSB Ribonuclease PH OS=Azoarcus sp. (strain BH72) GN=rph PE=3 SV=1 1055 1270 5.0E-06
sp|A0K5H3|RNPH_BURCH Ribonuclease PH OS=Burkholderia cenocepacia (strain HI2424) GN=rph PE=3 SV=1 1051 1270 5.0E-06
sp|B1JXM2|RNPH_BURCC Ribonuclease PH OS=Burkholderia cenocepacia (strain MC0-3) GN=rph PE=3 SV=1 1051 1270 5.0E-06
sp|Q1BY75|RNPH_BURCA Ribonuclease PH OS=Burkholderia cenocepacia (strain AU 1054) GN=rph PE=3 SV=1 1051 1270 5.0E-06
sp|Q9AES0|RNPH_MANHA Ribonuclease PH OS=Mannheimia haemolytica GN=rph PE=3 SV=1 1055 1249 5.0E-06
sp|A9AEQ7|RNPH_BURM1 Ribonuclease PH OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=rph PE=3 SV=1 1051 1270 6.0E-06
sp|A4Y0L7|RNPH_PSEMY Ribonuclease PH OS=Pseudomonas mendocina (strain ymp) GN=rph PE=3 SV=1 1054 1245 6.0E-06
sp|Q63RV5|RNPH_BURPS Ribonuclease PH OS=Burkholderia pseudomallei (strain K96243) GN=rph PE=3 SV=1 1051 1270 7.0E-06
sp|A3NY37|RNPH_BURP0 Ribonuclease PH OS=Burkholderia pseudomallei (strain 1106a) GN=rph PE=3 SV=1 1051 1270 7.0E-06
sp|Q62HZ8|RNPH_BURMA Ribonuclease PH OS=Burkholderia mallei (strain ATCC 23344) GN=rph PE=3 SV=1 1051 1270 7.0E-06
sp|A2S9I2|RNPH_BURM9 Ribonuclease PH OS=Burkholderia mallei (strain NCTC 10229) GN=rph PE=3 SV=1 1051 1270 7.0E-06
sp|A3MML4|RNPH_BURM7 Ribonuclease PH OS=Burkholderia mallei (strain NCTC 10247) GN=rph PE=3 SV=1 1051 1270 7.0E-06
sp|A3NC95|RNPH_BURP6 Ribonuclease PH OS=Burkholderia pseudomallei (strain 668) GN=rph PE=3 SV=1 1051 1270 8.0E-06
sp|Q5WEM3|RNPH_BACSK Ribonuclease PH OS=Bacillus clausii (strain KSM-K16) GN=rph PE=3 SV=1 1055 1244 8.0E-06
sp|B4S201|RNPH_ALTMD Ribonuclease PH OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=rph1 PE=3 SV=1 1055 1246 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 60 82 22
2 143 165 22
3 187 206 19
4 518 540 22
5 560 582 22
6 608 630 22
7 654 676 22
8 718 740 22
9 765 787 22
10 794 816 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2163
MTEPLDALPDANLGRWLLRRGLLDIFKDSKDPRVGSNRGDSSGPGTISSANNKTSSLSKLAATFIPVLVFLVVCF
LLFSFLRPKCRRVFAPRSIPGLREPQLPSPPLPPGWFNWIIPFYKIPDSFVLNHGSLDGFFFLRFLKVLRNICLG
GCLILWPVLFPIHATGGGGLSELELLTIGNVKDPTKLYAHAVMGWIFFGFVLYMIVRECIYYVNLRQAYLSSPYY
SRRISSRTMLLTCVPKEYLDPRRLRKLYGPSVERIHIPRTTKALANLVQEREQTASRLEKAEIKLILKANKARRK
KIDKTAAKPDGASQESSVTGSLASRHDLVRDSGKMASTRGDHLVLDLPGSYIEFAPSDLKTAADGVLKEALGHGV
NDDDVGDCDDEYTHPYGLDHDLPDVRGSVAARWIPVESRPYHRPLGNFGRRVDTIRWTRNRLRELNLQIYKMRRQ
VRRGDGTTLPAAFIEFDSQESAQAAHQVLAHHRPLQMSSRILGIHPGEVLWKSLRMPWWELIMRRFAIMSFVCAA
VIFWSIPSAVIGLVSQINFLSGIVVLSWLKKLPDLVLGFLTGFVPSLALSMWMAAVPGMLRICGAQAGIPSVTMV
ELFVQKAYFAFQVVQVFLITTLTSAASAAFTKILENPIGIKDVLAKNLPMASNFYLSYILIQCLASSGATLLQVF
NLIRHHLLAKMSVIPRAQYSTWRRLPAPRWGGIFPVFANMGVIALSYACIAPLILIFAAGGMMAMQFVWRYNILY
VLDSGLDSKGLFYPHALLHLTIGLYLAEICLIGLFALHLAFGPLAMMVIFLIFTGLVHVSLMQAILPLLQNLPQT
LSLEAEIQEEDKAAAERAKLQATARSDNEGAPTGAASSYYDPEQAFGEEGVRVDHDDDEDEEEEEDEDEATTTND
RALEGASGVKAALGEWFKSSTRSKFQEQAESLGMTKMMESFRQWMGQKKSDGSPGFLARWLHPEEYEDFIALRRL
IPPDSLPNIEYPEDHKYCDYLPPETWMPKPTLWIPRDEARVSRQEVAHSRKYTPISDIGANQRTKTIMPLDTSAY
TLSLLRVDGRRWNDLRRLHARLRTQDAADGSAYLEMGHTKVMCTVSGPAEQVVKRGGGGGGGDGRASVVVDVVVA
GFAGVERKRRGRNDRRIQEMEITVARTLSAAIHTHLFPHSTISLSLHVLSTDGSLLAALLNASTLALIDAGVPMT
DYVVACTSGTTSSSSFTTDTDPLLDLNAQEEMELPFVTVAAVGEGDGVAALVSESRLQVGALEGLLAVGLEGCAV
FR*
Coding >Ophun1|2163
ATGACGGAGCCGCTTGATGCCCTCCCCGACGCCAACCTGGGCCGCTGGCTCCTCAGACGCGGCCTCCTAGACATA
TTCAAGGATAGCAAAGATCCCCGCGTCGGTTCCAATCGCGGCGATTCCTCCGGCCCAGGCACCATCAGTTCCGCC
AACAACAAGACTTCGTCTCTCAGCAAGCTCGCCGCCACCTTTATCCCCGTCCTCGTCTTTCTCGTCGTCTGCTTC
CTGCTCTTCTCCTTTCTCCGCCCGAAATGTCGTCGCGTCTTTGCTCCGCGGTCCATTCCCGGTCTCCGCGAGCCG
CAGCTGCCGAGTCCCCCCTTACCACCCGGCTGGTTCAACTGGATCATTCCGTTTTATAAGATTCCAGATAGCTTT
GTCCTCAATCACGGCTCGCTCGACGGATTCTTCTTCCTCCGCTTTCTCAAGGTCTTGAGAAACATCTGCCTTGGT
GGCTGTCTCATTCTATGGCCCGTCCTCTTCCCCATCCACGCCACCGGCGGCGGCGGTCTCTCCGAGCTCGAACTC
TTGACCATAGGCAATGTCAAGGATCCGACCAAGCTGTATGCTCATGCCGTCATGGGCTGGATTTTCTTCGGCTTC
GTGCTCTACATGATTGTCCGCGAATGCATCTACTACGTCAATCTGCGTCAAGCCTATCTCTCTTCGCCCTACTAT
TCGCGCCGCATCTCGTCGAGGACTATGCTTCTGACGTGCGTGCCGAAAGAGTACCTCGACCCGCGCCGTCTGCGC
AAACTGTACGGTCCCTCGGTCGAGCGCATACACATACCGCGCACCACAAAGGCATTGGCCAATCTGGTTCAAGAG
CGCGAGCAGACGGCGTCGAGGCTCGAAAAGGCAGAGATCAAACTGATACTCAAAGCGAACAAGGCTCGCCGCAAG
AAAATCGACAAGACAGCCGCCAAGCCTGATGGAGCGTCGCAGGAGTCGTCTGTGACGGGCTCTCTGGCCTCGAGA
CACGATCTTGTCCGGGACAGCGGAAAGATGGCGTCCACTCGCGGCGACCATCTCGTCCTCGACCTGCCCGGATCC
TACATCGAGTTCGCGCCCTCGGACCTAAAGACGGCCGCCGACGGGGTGCTCAAAGAGGCACTCGGTCACGGCGTC
AACGACGACGACGTGGGAGACTGCGACGACGAATACACCCACCCATACGGGCTCGACCATGACCTACCAGACGTC
AGGGGCTCCGTCGCCGCCAGATGGATTCCCGTCGAATCGCGGCCCTACCACCGGCCACTGGGAAACTTTGGCCGT
CGCGTCGACACCATCCGCTGGACGAGGAACCGGCTGCGAGAGCTCAACCTCCAAATCTACAAGATGCGCCGTCAG
GTTCGAAGGGGTGACGGCACCACGCTTCCGGCCGCCTTCATCGAGTTTGACAGCCAGGAGAGCGCACAGGCAGCG
CACCAGGTCCTCGCCCACCATCGGCCGCTTCAGATGTCGTCGCGCATTCTCGGCATCCACCCTGGCGAGGTGCTG
TGGAAGTCGCTGCGCATGCCCTGGTGGGAGCTCATCATGCGCCGGTTCGCCATCATGTCCTTTGTCTGCGCCGCC
GTAATCTTCTGGTCGATTCCTTCTGCCGTCATCGGCCTGGTCTCGCAGATCAACTTTCTGTCCGGTATCGTGGTT
CTCTCGTGGCTCAAGAAGCTCCCGGATCTGGTCCTTGGCTTTCTCACTGGCTTCGTGCCCTCGCTTGCCTTGTCC
ATGTGGATGGCTGCCGTCCCCGGCATGCTGCGAATCTGCGGTGCTCAAGCCGGCATCCCCTCCGTTACCATGGTC
GAGCTGTTTGTTCAAAAGGCCTACTTTGCCTTTCAGGTTGTCCAGGTCTTTCTCATCACGACGCTCACGTCGGCT
GCCTCGGCCGCTTTTACCAAGATACTCGAGAATCCCATCGGCATCAAGGACGTGCTGGCCAAGAACCTGCCCATG
GCATCCAACTTCTACCTCTCGTACATCCTCATCCAGTGTCTAGCCAGCAGCGGCGCGACACTACTGCAGGTATTC
AATCTGATACGGCACCACCTACTGGCCAAGATGTCCGTCATTCCCCGAGCGCAGTACTCGACGTGGCGAAGGCTC
CCGGCGCCGCGCTGGGGCGGCATCTTCCCTGTCTTTGCCAACATGGGCGTCATCGCCTTGAGCTACGCCTGCATT
GCTCCCTTGATTCTCATCTTTGCTGCCGGCGGCATGATGGCGATGCAATTCGTCTGGCGGTACAACATACTCTAC
GTCCTCGACTCGGGATTGGATAGCAAGGGTCTCTTCTATCCGCACGCCCTCCTGCACCTCACCATCGGCCTCTAC
CTGGCTGAAATTTGTCTCATCGGGCTGTTTGCCCTCCACTTGGCTTTTGGGCCGCTCGCCATGATGGTCATATTC
CTCATCTTTACAGGATTAGTGCACGTTTCACTCATGCAAGCCATCTTGCCGCTTCTGCAAAACCTCCCGCAGACG
CTGTCACTGGAAGCCGAGATCCAAGAGGAGGACAAGGCAGCAGCGGAGAGGGCCAAGCTACAGGCCACGGCCAGG
AGCGACAACGAGGGCGCACCGACCGGGGCCGCGAGCAGCTACTACGACCCGGAACAAGCATTTGGAGAGGAGGGG
GTGAGGGTCGACCACGACGACGACGAAGACGAGGAAGAAGAGGAGGACGAGGACGAAGCGACGACGACCAACGAC
CGGGCTCTCGAGGGCGCCAGCGGTGTCAAGGCTGCCCTCGGCGAGTGGTTCAAGTCGAGCACGCGGTCCAAGTTT
CAGGAGCAGGCCGAGAGCCTCGGAATGACCAAGATGATGGAGAGCTTCCGGCAGTGGATGGGCCAGAAGAAGAGC
GACGGGTCGCCGGGCTTTCTGGCCAGGTGGCTGCACCCCGAAGAGTACGAGGACTTTATCGCGCTGCGGAGGTTG
ATACCGCCCGACAGCCTGCCCAACATTGAGTATCCGGAAGATCACAAGTACTGCGACTACCTGCCGCCGGAGACG
TGGATGCCCAAGCCGACGCTCTGGATCCCGCGGGACGAGGCGCGGGTGAGCCGTCAGGAGGTGGCGCACTCGAGG
AAGTACACGCCCATCTCTGATATTGGGGCGAACCAAAGAACAAAGACCATCATGCCCCTCGACACCTCAGCCTAC
ACCCTCTCCCTCCTCCGCGTCGACGGCCGCCGCTGGAACGACCTCCGCCGCCTGCACGCCCGTCTCCGCACCCAA
GATGCAGCCGACGGCTCGGCCTACCTGGAAATGGGGCACACCAAGGTCATGTGCACGGTTTCCGGGCCGGCGGAG
CAGGTGGTGAAGAGGGGAGGAGGAGGAGGAGGAGGGGATGGGAGGGCGAGTGTGGTGGTTGATGTTGTGGTTGCT
GGGTTTGCCGGCGTGGAGAGGAAGAGGAGGGGGAGGAATGATCGGCGGATACAGGAGATGGAGATTACGGTTGCG
AGGACGCTTTCCGCTGCGATTCATACCCATCTGTTTCCGCATTCGACCATCAGTCTATCCCTCCACGTCCTCTCA
ACAGACGGTTCCCTCCTAGCCGCCCTCCTCAACGCCTCAACCCTCGCCCTCATCGACGCCGGCGTCCCGATGACG
GACTACGTGGTAGCCTGCACGTCCGGCACCACGTCGTCCTCGTCCTTCACGACGGACACGGACCCGCTGCTGGAC
CTGAACGCGCAGGAGGAGATGGAGCTGCCCTTCGTGACGGTGGCGGCCGTGGGCGAGGGGGATGGCGTTGCGGCG
CTGGTGTCGGAGAGCCGCCTGCAGGTTGGGGCTTTGGAGGGGTTGCTGGCGGTTGGGTTGGAGGGGTGTGCCGTC
TTCAGGTGA
Transcript >Ophun1|2163
ATGACGGAGCCGCTTGATGCCCTCCCCGACGCCAACCTGGGCCGCTGGCTCCTCAGACGCGGCCTCCTAGACATA
TTCAAGGATAGCAAAGATCCCCGCGTCGGTTCCAATCGCGGCGATTCCTCCGGCCCAGGCACCATCAGTTCCGCC
AACAACAAGACTTCGTCTCTCAGCAAGCTCGCCGCCACCTTTATCCCCGTCCTCGTCTTTCTCGTCGTCTGCTTC
CTGCTCTTCTCCTTTCTCCGCCCGAAATGTCGTCGCGTCTTTGCTCCGCGGTCCATTCCCGGTCTCCGCGAGCCG
CAGCTGCCGAGTCCCCCCTTACCACCCGGCTGGTTCAACTGGATCATTCCGTTTTATAAGATTCCAGATAGCTTT
GTCCTCAATCACGGCTCGCTCGACGGATTCTTCTTCCTCCGCTTTCTCAAGGTCTTGAGAAACATCTGCCTTGGT
GGCTGTCTCATTCTATGGCCCGTCCTCTTCCCCATCCACGCCACCGGCGGCGGCGGTCTCTCCGAGCTCGAACTC
TTGACCATAGGCAATGTCAAGGATCCGACCAAGCTGTATGCTCATGCCGTCATGGGCTGGATTTTCTTCGGCTTC
GTGCTCTACATGATTGTCCGCGAATGCATCTACTACGTCAATCTGCGTCAAGCCTATCTCTCTTCGCCCTACTAT
TCGCGCCGCATCTCGTCGAGGACTATGCTTCTGACGTGCGTGCCGAAAGAGTACCTCGACCCGCGCCGTCTGCGC
AAACTGTACGGTCCCTCGGTCGAGCGCATACACATACCGCGCACCACAAAGGCATTGGCCAATCTGGTTCAAGAG
CGCGAGCAGACGGCGTCGAGGCTCGAAAAGGCAGAGATCAAACTGATACTCAAAGCGAACAAGGCTCGCCGCAAG
AAAATCGACAAGACAGCCGCCAAGCCTGATGGAGCGTCGCAGGAGTCGTCTGTGACGGGCTCTCTGGCCTCGAGA
CACGATCTTGTCCGGGACAGCGGAAAGATGGCGTCCACTCGCGGCGACCATCTCGTCCTCGACCTGCCCGGATCC
TACATCGAGTTCGCGCCCTCGGACCTAAAGACGGCCGCCGACGGGGTGCTCAAAGAGGCACTCGGTCACGGCGTC
AACGACGACGACGTGGGAGACTGCGACGACGAATACACCCACCCATACGGGCTCGACCATGACCTACCAGACGTC
AGGGGCTCCGTCGCCGCCAGATGGATTCCCGTCGAATCGCGGCCCTACCACCGGCCACTGGGAAACTTTGGCCGT
CGCGTCGACACCATCCGCTGGACGAGGAACCGGCTGCGAGAGCTCAACCTCCAAATCTACAAGATGCGCCGTCAG
GTTCGAAGGGGTGACGGCACCACGCTTCCGGCCGCCTTCATCGAGTTTGACAGCCAGGAGAGCGCACAGGCAGCG
CACCAGGTCCTCGCCCACCATCGGCCGCTTCAGATGTCGTCGCGCATTCTCGGCATCCACCCTGGCGAGGTGCTG
TGGAAGTCGCTGCGCATGCCCTGGTGGGAGCTCATCATGCGCCGGTTCGCCATCATGTCCTTTGTCTGCGCCGCC
GTAATCTTCTGGTCGATTCCTTCTGCCGTCATCGGCCTGGTCTCGCAGATCAACTTTCTGTCCGGTATCGTGGTT
CTCTCGTGGCTCAAGAAGCTCCCGGATCTGGTCCTTGGCTTTCTCACTGGCTTCGTGCCCTCGCTTGCCTTGTCC
ATGTGGATGGCTGCCGTCCCCGGCATGCTGCGAATCTGCGGTGCTCAAGCCGGCATCCCCTCCGTTACCATGGTC
GAGCTGTTTGTTCAAAAGGCCTACTTTGCCTTTCAGGTTGTCCAGGTCTTTCTCATCACGACGCTCACGTCGGCT
GCCTCGGCCGCTTTTACCAAGATACTCGAGAATCCCATCGGCATCAAGGACGTGCTGGCCAAGAACCTGCCCATG
GCATCCAACTTCTACCTCTCGTACATCCTCATCCAGTGTCTAGCCAGCAGCGGCGCGACACTACTGCAGGTATTC
AATCTGATACGGCACCACCTACTGGCCAAGATGTCCGTCATTCCCCGAGCGCAGTACTCGACGTGGCGAAGGCTC
CCGGCGCCGCGCTGGGGCGGCATCTTCCCTGTCTTTGCCAACATGGGCGTCATCGCCTTGAGCTACGCCTGCATT
GCTCCCTTGATTCTCATCTTTGCTGCCGGCGGCATGATGGCGATGCAATTCGTCTGGCGGTACAACATACTCTAC
GTCCTCGACTCGGGATTGGATAGCAAGGGTCTCTTCTATCCGCACGCCCTCCTGCACCTCACCATCGGCCTCTAC
CTGGCTGAAATTTGTCTCATCGGGCTGTTTGCCCTCCACTTGGCTTTTGGGCCGCTCGCCATGATGGTCATATTC
CTCATCTTTACAGGATTAGTGCACGTTTCACTCATGCAAGCCATCTTGCCGCTTCTGCAAAACCTCCCGCAGACG
CTGTCACTGGAAGCCGAGATCCAAGAGGAGGACAAGGCAGCAGCGGAGAGGGCCAAGCTACAGGCCACGGCCAGG
AGCGACAACGAGGGCGCACCGACCGGGGCCGCGAGCAGCTACTACGACCCGGAACAAGCATTTGGAGAGGAGGGG
GTGAGGGTCGACCACGACGACGACGAAGACGAGGAAGAAGAGGAGGACGAGGACGAAGCGACGACGACCAACGAC
CGGGCTCTCGAGGGCGCCAGCGGTGTCAAGGCTGCCCTCGGCGAGTGGTTCAAGTCGAGCACGCGGTCCAAGTTT
CAGGAGCAGGCCGAGAGCCTCGGAATGACCAAGATGATGGAGAGCTTCCGGCAGTGGATGGGCCAGAAGAAGAGC
GACGGGTCGCCGGGCTTTCTGGCCAGGTGGCTGCACCCCGAAGAGTACGAGGACTTTATCGCGCTGCGGAGGTTG
ATACCGCCCGACAGCCTGCCCAACATTGAGTATCCGGAAGATCACAAGTACTGCGACTACCTGCCGCCGGAGACG
TGGATGCCCAAGCCGACGCTCTGGATCCCGCGGGACGAGGCGCGGGTGAGCCGTCAGGAGGTGGCGCACTCGAGG
AAGTACACGCCCATCTCTGATATTGGGGCGAACCAAAGAACAAAGACCATCATGCCCCTCGACACCTCAGCCTAC
ACCCTCTCCCTCCTCCGCGTCGACGGCCGCCGCTGGAACGACCTCCGCCGCCTGCACGCCCGTCTCCGCACCCAA
GATGCAGCCGACGGCTCGGCCTACCTGGAAATGGGGCACACCAAGGTCATGTGCACGGTTTCCGGGCCGGCGGAG
CAGGTGGTGAAGAGGGGAGGAGGAGGAGGAGGAGGGGATGGGAGGGCGAGTGTGGTGGTTGATGTTGTGGTTGCT
GGGTTTGCCGGCGTGGAGAGGAAGAGGAGGGGGAGGAATGATCGGCGGATACAGGAGATGGAGATTACGGTTGCG
AGGACGCTTTCCGCTGCGATTCATACCCATCTGTTTCCGCATTCGACCATCAGTCTATCCCTCCACGTCCTCTCA
ACAGACGGTTCCCTCCTAGCCGCCCTCCTCAACGCCTCAACCCTCGCCCTCATCGACGCCGGCGTCCCGATGACG
GACTACGTGGTAGCCTGCACGTCCGGCACCACGTCGTCCTCGTCCTTCACGACGGACACGGACCCGCTGCTGGAC
CTGAACGCGCAGGAGGAGATGGAGCTGCCCTTCGTGACGGTGGCGGCCGTGGGCGAGGGGGATGGCGTTGCGGCG
CTGGTGTCGGAGAGCCGCCTGCAGGTTGGGGCTTTGGAGGGGTTGCTGGCGGTTGGGTTGGAGGGGTGTGCCGTC
TTCAGGTGA
Gene >Ophun1|2163
ATGACGGAGCCGCTTGATGCCCTCCCCGACGCCAACCTGGGCCGCTGGCTCCTCAGACGCGGCCTCCTAGACATA
TTCGTTCGTCGCTCTTCTTACTCTGTTGATCGTCAACCAAGTATTCACTCACACGTCGGCTGTAGAAGGATAGCA
AAGATCCCCGCGTCGGTTCCAATCGCGGCGATTCCTCCGGCCCAGGCACCATCAGTTCCGCCAACAACAAGACTT
CGTCTCTCAGCAAGCTCGCCGCCACCTTTATCCCCGTCCTCGTCTTTCTCGTCGTCTGCTTCCTGCTCTTCTCCT
TTCTCCGCCCGAAATGTCGTCGCGTCTTTGCTCCGCGGTCCATTCCCGGTCTCCGCGAGCCGCAGTTGGTGCCCC
AACGCCTCTGTCATGTCTTGCGCAGTGCTCACCTCCCGCTGCAGGCTGCCGAGTCCCCCCTTACCACCCGGCTGG
TTCAACTGGATCATTCCGTTTTATAAGATTCCAGATAGCTTTGTCCTCAATCACGGCTCGCTCGACGGATTCTTC
TTCCTCCGCTTTCTCAAGGTCTTGAGAAACATCTGCCTTGGTGGCTGTCTCATTCTATGGCCCGTCCTCTTCCCC
ATCCACGCCACCGGCGGCGGCGGTCTCTCCGAGCTCGAACTCTTGACCATAGGCAATGTCAAGGATCCGACCAAG
CTGTATGCTCATGCCGTCATGGGCTGGATTTTCTTCGGTACTGTTTTCTCGCCGCCTTTTCGAGTCATGATGACT
TACTCGTGACCTCTCAGGCTTCGTGCTCTACATGATTGTCCGCGAATGCATCTACTACGTCAATCTGCGTCAAGC
CTATCTCTCTTCGCCCTACTATTCGCGCCGCATCTCGTCGAGGACTATGCTTCTGACGTGCGTGCCGAAAGAGTA
CCTCGACCCGCGCCGTCTGCGCAAACTGTACGGTCCCTCGGTCGAGCGCATACACATACCGCGCACCACAAAGGC
ATTGGCCAATCTGGTTCAAGAGCGCGAGCAGACGGCGTCGAGGCTCGAAAAGGCAGAGATCAAACTGATACTCAA
AGCGAACAAGGCTCGCCGCAAGAAAATCGACAAGACAGCCGCCAAGCCTGATGGAGCGTCGCAGGAGTCGTCTGT
GACGGGCTCTCTGGCCTCGAGACACGATCTTGTCCGGGACAGCGGAAAGATGGCGTCCACTCGCGGCGACCATCT
CGTCCTCGACCTGCCCGGATCCTACATCGAGTTCGCGCCCTCGGACCTAAAGACGGCCGCCGACGGGGTGCTCAA
AGAGGCACTCGGTCACGGCGTCAACGACGACGACGTGGGAGACTGCGACGACGAATACACCCACCCATACGGGCT
CGACCATGACCTACCAGACGTCAGGGGCTCCGTCGCCGCCAGATGGATTCCCGTCGAATCGCGGCCCTACCACCG
GCCACTGGGAAACTTTGGCCGTCGCGTCGACACCATCCGCTGGACGAGGAACCGGCTGCGAGAGCTCAACCTCCA
AATCTACAAGATGCGCCGTCAGGTTCGAAGGGGTGACGGCACCACGCTTCCGGCCGCCTTCATCGAGTTTGACAG
CCAGGAGAGCGCACAGGCAGCGCACCAGGTCCTCGCCCACCATCGGCCGCTTCAGATGTCGTCGCGCATTCTCGG
CATCCACCCTGGCGAGGTGCTGTGGAAGTCGCTGCGCATGCCCTGGTGGGAGCTCATCATGCGCCGGTTCGCCAT
CATGTCCTTTGTCTGCGCCGCCGTAATCTTCTGGTCGATTCCTTCTGCCGTCATCGGCCTGGTCTCGCAGATCAA
CTTTCTGTCCGGTATCGTGGTTCTCTCGTGGCTCAAGAAGCTCCCGGATCTGGTCCTTGGCTTTCTCACTGGCTT
CGTGCCCTCGCTTGCCTTGTCCATGTGGATGGCTGCCGTCCCCGGCATGCTGCGAAGTGCGAATGACCCATCGTA
TATCTGTTCTTCGTGCTGTGCGTCTGCTGACGGTGGTACAGTCTGCGGTGCTCAAGCCGGCATCCCCTCCGTTAC
CATGGTCGAGCTGTTTGTTCAAAAGGCCTACTTTGCCTTTCAGGTTGTCCAGGTCTTTCTCATCACGACGCTCAC
GTCGGCTGCCTCGGCCGCTTTTACCAAGATACTCGAGAATCCCATCGGCATCAAGGACGTGCTGGCCAAGAACCT
GCCCATGGCATCCAACTTCTACCTCTCGTACATCCTCATCCAGTGTCTAGCCAGCAGCGGCGCGACACTACTGCA
GGTATTCAATCTGATACGGCACCACCTACTGGCCAAGATGTCCGTCATTCCCCGAGCGCAGTACTCGACGTGGCG
AAGGCTCCCGGCGCCGCGCTGGGGCGGCATCTTCCCTGTCTTTGCCAACATGGGCGTCATCGGTGAGTCTTGTCC
CACATGCCGGTATGCTGCGTGACGACCTGACGCTGTGCAGCCTTGAGCTACGCCTGCATTGCTCCCTTGATTCTC
ATCTTTGCTGCCGGCGGCATGATGGCGATGCAATTCGTCTGGCGGTACAACATACTCTACGTCCTCGACTCGGGA
TTGGATAGCAAGGGTCTCTTCTATCCGCACGCCCTCCTGCACCTCACCATCGGCCTCTACCTGGCTGAAATTTGT
CTCATCGGGCTGTTTGCCCTCCACTTGGCTTTTGGGCCGCTCGCCATGATGGTCATATTCCTCATCTTTACAGGA
TTAGTGCACGTTTCACTCATGCAAGCCATCTTGCCGCTTCTGCAAAACCTCCCGCAGACGCTGTCACTGGAAGCC
GAGATCCAAGAGGAGGACAAGGCAGCAGCGGAGAGGGCCAAGCTACAGGCCACGGCCAGGAGCGACAACGAGGGC
GCACCGACCGGGGCCGCGAGCAGCTACTACGACCCGGAACAAGCATTTGGAGAGGAGGGGGTGAGGGTCGACCAC
GACGACGACGAAGACGAGGAAGAAGAGGAGGACGAGGACGAAGCGACGACGACCAACGACCGGGCTCTCGAGGGC
GCCAGCGGTGTCAAGGCTGCCCTCGGCGAGTGGTTCAAGTCGAGCACGCGGTCCAAGTTTCAGGAGCAGGCCGAG
AGCCTCGGAATGACCAAGATGATGGAGAGCTTCCGGCAGTGGATGGGCCAGAAGAAGAGCGACGGGTCGCCGGGC
TTTCTGGCCAGGTGGCTGCACCCCGAAGAGTACGAGGACTTTATCGCGCTGCGGAGGTTGATACCGCCCGACAGC
CTGCCCAACATTGAGTATCCGGAAGATCACAAGTACTGCGACTACCTGCCGCCGGAGACGTGGATGCCCAAGCCG
ACGCTCTGGATCCCGCGGGACGAGGCGCGGGTGAGCCGTCAGGAGGTGGCGCACTCGAGGAAGTACACGCCCATC
TCTGATATTGGGGCGTCGTTGGATGAGAAGGGGCATATATATACGTGTTTTGACCAAGCGCCGTTTGATAGGTCC
AAGGTTATTATATAGACGAGGGGTAGATGGAGTGAAAGAATAAATAAGATGTTGTGAAACTGATGTATGTTGAGG
CTATGTCTGATGTGCAAATGGACAGAGAAGTAAGGCTGAGAAGAGTGGCATATATTCTTTGCATTCGTAGGTGAT
ACAATAAGAAGAGGAGATGTGGCAGCTCTACTTCGTACGTGCTGTAAGAAATCACGCAAGATCAGGCTTCGTCAG
GGGCTACATTAATTCTGGGCTTCCTTCCGGACGCGGAACATGACGTCGGGTGGGGGCTAGACGCTTGAAGGAGCG
TGTCAATGCGTGGTGTATATATCATGTTTGTGCTTGTATTCGTAGATGAACTCGATTGGCGCAGGATGCAAGAGG
GCGAAGGTGTTTCGTGTTAGTGAAGATGCTGGTGATGATGGAGGCTGCACCGCCGCAAATCGATATCTGCACCGC
CACAAATCGACATGGCGGTGCACCACCCCACTCTAGATCTCGATAAGAATCCCCCCCAAGAAAACCCTCAACAAC
TCCAAAGGAACCAAAGAACAAAGACCATCATGCCCCTCGACACCTCAGCCTACACCCTCTCCCTCCTCCGCGTCG
ACGGCCGCCGCTGGAACGACCTCCGCCGCCTGCACGCCCGTCTCCGCACCCAAGATGCAGCCGACGGCTCGGCCT
ACCTGGAAATGGGGCACACCAAGGTCATGTGCACGGTTTCCGGGCCGGCGGAGCAGGTGGTGAAGAGGGGAGGAG
GAGGAGGAGGAGGGGATGGGAGGGCGAGTGTGGTGGTTGATGTTGTGGTTGCTGGGTTTGCCGGCGTGGAGAGGA
AGAGGAGGGGGAGGAATGATCGGTGAGTTTTTGTTGGTTTTGATGGGTTGATTGATGGGGAGGGTTGCTTACTGG
TTGAGGGTTCAGGCGGATACAGGAGATGGAGATTACGGTTGCGAGGACGCTTTCCGCTGCGATTCATACCCATCT
GTTTCCGCATTCGACCATCAGTCTATCCCTCCACGTCCTCTCAACAGACGGTTCCCTCCTAGCCGCCCTCCTCAA
CGCCTCAACCCTCGCCCTCATCGACGCCGGCGTCCCGATGACGGACTACGTGGTAGCCTGCACGTCCGGCACCAC
GTCGTCCTCGTCCTTCACGACGGACACGGACCCGCTGCTGGACCTGAACGCGCAGGAGGAGATGGAGCTGCCCTT
CGTGACGGTGGCGGCCGTGGGCGAGGGGGATGGCGTTGCGGCGCTGGTGTCGGAGAGCCGCCTGCAGGTTGGGGC
TTTGGAGGGGTTGCTGGCGGTTGGGTTGGAGGGGTGTAGGCAGGTTAGGGGGTTGTTGGATGGGGTTGTGAGGGA
GAGGGGGGTGAGGATGATTCGGGAGGGGGCGGTTGAGAGGAGTGAGGATAGGCTTGCGGGGTTGGAGGGGTGATG
GGGGGGCCGGGGTTGAGAGGGATGTTAGTTGGGGATGTTGAGATGGGGATGGGGATGGATATGAGGTGCCGTCTT
CAGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail