Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|216
Gene name
LocationContig_1042:719..1496
Strand-
Gene length (bp)777
Transcript length (bp)777
Coding sequence length (bp)777
Protein length (aa) 259

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01182 Glucosamine_iso Glucosamine-6-phosphate isomerases/6-phosphogluconolactonase 9.7E-72 13 234

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74455|6PGL_SCHPO Probable 6-phosphogluconolactonase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC16C4.10 PE=3 SV=1 7 246 3.0E-82
sp|P50278|SOL1_YEAST 6-phosphogluconolactonase-like protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SOL1 PE=1 SV=1 39 257 7.0E-64
sp|P37262|SOL2_YEAST 6-phosphogluconolactonase-like protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SOL2 PE=1 SV=2 39 257 8.0E-62
sp|P38858|SOL3_YEAST 6-phosphogluconolactonase 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SOL3 PE=1 SV=2 11 250 1.0E-61
sp|A6ZT71|SOL3_YEAS7 6-phosphogluconolactonase 3 OS=Saccharomyces cerevisiae (strain YJM789) GN=SOL3 PE=3 SV=1 11 250 1.0E-61
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74455|6PGL_SCHPO Probable 6-phosphogluconolactonase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC16C4.10 PE=3 SV=1 7 246 3.0E-82
sp|P50278|SOL1_YEAST 6-phosphogluconolactonase-like protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SOL1 PE=1 SV=1 39 257 7.0E-64
sp|P37262|SOL2_YEAST 6-phosphogluconolactonase-like protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SOL2 PE=1 SV=2 39 257 8.0E-62
sp|P38858|SOL3_YEAST 6-phosphogluconolactonase 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SOL3 PE=1 SV=2 11 250 1.0E-61
sp|A6ZT71|SOL3_YEAS7 6-phosphogluconolactonase 3 OS=Saccharomyces cerevisiae (strain YJM789) GN=SOL3 PE=3 SV=1 11 250 1.0E-61
sp|B5VK90|SOL3_YEAS6 6-phosphogluconolactonase 3 OS=Saccharomyces cerevisiae (strain AWRI1631) GN=SOL3 PE=3 SV=1 11 250 1.0E-61
sp|B3LSS7|SOL3_YEAS1 6-phosphogluconolactonase 3 OS=Saccharomyces cerevisiae (strain RM11-1a) GN=SOL3 PE=3 SV=1 11 250 1.0E-61
sp|P85971|6PGL_RAT 6-phosphogluconolactonase OS=Rattus norvegicus GN=Pgls PE=1 SV=1 1 253 8.0E-50
sp|P53315|SOL4_YEAST 6-phosphogluconolactonase 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SOL4 PE=1 SV=1 8 246 2.0E-49
sp|O95336|6PGL_HUMAN 6-phosphogluconolactonase OS=Homo sapiens GN=PGLS PE=1 SV=2 1 253 4.0E-49
sp|Q9CQ60|6PGL_MOUSE 6-phosphogluconolactonase OS=Mus musculus GN=Pgls PE=1 SV=1 1 253 2.0E-48
sp|Q2TBQ8|6PGL_BOVIN 6-phosphogluconolactonase OS=Bos taurus GN=PGLS PE=2 SV=1 1 253 1.0E-45
sp|Q6Z9C3|6PGL3_ORYSJ Probable 6-phosphogluconolactonase 3, chloroplastic OS=Oryza sativa subsp. japonica GN=Os08g0547100 PE=2 SV=1 7 247 1.0E-45
sp|A2YXS5|6PGL3_ORYSI Probable 6-phosphogluconolactonase 3, chloroplastic OS=Oryza sativa subsp. indica GN=OsI_30141 PE=3 SV=2 7 247 1.0E-45
sp|Q69NG5|6PGL4_ORYSJ Probable 6-phosphogluconolactonase 4, chloroplastic OS=Oryza sativa subsp. japonica GN=Os09g0529100 PE=2 SV=2 2 247 1.0E-44
sp|A2Z3C4|6PGL4_ORYSI Probable 6-phosphogluconolactonase 4, chloroplastic OS=Oryza sativa subsp. indica GN=OsI_031067 PE=3 SV=2 2 247 2.0E-44
sp|Q84WW2|6PGL5_ARATH Probable 6-phosphogluconolactonase 5, chloroplastic OS=Arabidopsis thaliana GN=EMB2024 PE=2 SV=1 37 246 2.0E-41
sp|Q9VZ64|6PGL_DROME Probable 6-phosphogluconolactonase OS=Drosophila melanogaster GN=CG17333 PE=2 SV=1 1 246 4.0E-41
sp|Q9FIN1|6PGL4_ARATH Probable 6-phosphogluconolactonase 4 OS=Arabidopsis thaliana GN=At5g24410 PE=2 SV=1 1 250 2.0E-39
sp|Q9LMX8|6PGL1_ARATH Probable 6-phosphogluconolactonase 1 OS=Arabidopsis thaliana GN=At1g13700 PE=2 SV=1 3 246 3.0E-39
sp|Q6Z4H0|6PGL2_ORYSJ Probable 6-phosphogluconolactonase 2 OS=Oryza sativa subsp. japonica GN=Os07g0604000 PE=2 SV=1 3 246 3.0E-39
sp|A2YNH4|6PGL2_ORYSI Probable 6-phosphogluconolactonase 2 OS=Oryza sativa subsp. indica GN=OsI_025867 PE=3 SV=1 3 246 3.0E-39
sp|Q75IV7|6PGL1_ORYSJ Probable 6-phosphogluconolactonase 1 OS=Oryza sativa subsp. japonica GN=Os03g0416500 PE=2 SV=1 3 246 1.0E-37
sp|A2XI04|6PGL1_ORYSI Probable 6-phosphogluconolactonase 1 OS=Oryza sativa subsp. indica GN=OsI_011697 PE=3 SV=2 3 246 1.0E-37
sp|O18229|6PGL_CAEEL Putative 6-phosphogluconolactonase OS=Caenorhabditis elegans GN=Y57G11C.3 PE=3 SV=2 2 250 3.0E-37
sp|Q8LEV7|6PGL3_ARATH Probable 6-phosphogluconolactonase 3 OS=Arabidopsis thaliana GN=At5g24420 PE=2 SV=2 4 246 5.0E-35
sp|Q8LG70|6PGL2_ARATH Probable 6-phosphogluconolactonase 2 OS=Arabidopsis thaliana GN=At3g49360 PE=2 SV=2 11 246 1.0E-34
sp|Q9XAB7|6PGL_STRCO 6-phosphogluconolactonase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=pgl PE=3 SV=1 6 257 2.0E-28
sp|P9WQP5|6PGL_MYCTU 6-phosphogluconolactonase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pgl PE=1 SV=1 11 246 4.0E-28
sp|P63339|6PGL_MYCBO 6-phosphogluconolactonase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pgl PE=3 SV=1 11 246 4.0E-28
sp|P9WQP4|6PGL_MYCTO 6-phosphogluconolactonase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pgl PE=3 SV=1 11 246 4.0E-28
sp|Q49700|6PGL_MYCLE 6-phosphogluconolactonase OS=Mycobacterium leprae (strain TN) GN=pgl PE=3 SV=1 23 246 4.0E-25
sp|P74618|6PGL_SYNY3 6-phosphogluconolactonase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=pgl PE=1 SV=3 30 250 6.0E-25
sp|Q57039|6PGL_HAEIN 6-phosphogluconolactonase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=pgl PE=3 SV=2 41 247 1.0E-24
sp|P46016|6PGL_NOSS1 6-phosphogluconolactonase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=pgl PE=2 SV=2 11 246 9.0E-23
sp|O95479|G6PE_HUMAN GDH/6PGL endoplasmic bifunctional protein OS=Homo sapiens GN=H6PD PE=1 SV=2 32 249 9.0E-22
sp|Q8CFX1|G6PE_MOUSE GDH/6PGL endoplasmic bifunctional protein OS=Mus musculus GN=H6pd PE=1 SV=2 3 249 1.0E-20
sp|P70715|6PGL_AGGAC 6-phosphogluconolactonase OS=Aggregatibacter actinomycetemcomitans GN=pgl PE=3 SV=2 41 248 2.0E-20
sp|Q9PKK7|6PGL_CHLMU 6-phosphogluconolactonase OS=Chlamydia muridarum (strain MoPn / Nigg) GN=pgl PE=3 SV=1 26 218 1.0E-18
sp|O83490|6PGL_TREPA 6-phosphogluconolactonase OS=Treponema pallidum (strain Nichols) GN=pgl PE=3 SV=1 9 228 1.0E-16
sp|P56201|G6PE_RABIT GDH/6PGL endoplasmic bifunctional protein OS=Oryctolagus cuniculus GN=H6PD PE=1 SV=2 3 249 3.0E-16
sp|O84189|6PGL_CHLTR 6-phosphogluconolactonase OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=pgl PE=3 SV=1 26 217 8.0E-16
sp|Q989A3|6PGL_RHILO 6-phosphogluconolactonase OS=Rhizobium loti (strain MAFF303099) GN=pgl PE=3 SV=1 7 211 1.0E-15
sp|P63337|6PGL_NEIMB 6-phosphogluconolactonase OS=Neisseria meningitidis serogroup B (strain MC58) GN=pgl PE=3 SV=1 15 244 5.0E-15
sp|P63336|6PGL_NEIMA 6-phosphogluconolactonase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=pgl PE=3 SV=1 15 244 5.0E-15
sp|O51240|6PGL_BORBU 6-phosphogluconolactonase OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=pgl PE=3 SV=1 41 191 2.0E-14
sp|Q9A6N1|6PGL_CAUCR 6-phosphogluconolactonase OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=pgl PE=3 SV=1 7 219 6.0E-14
sp|Q9Z8U5|6PGL_CHLPN 6-phosphogluconolactonase OS=Chlamydia pneumoniae GN=pgl PE=3 SV=1 26 241 7.0E-14
sp|Q9Z3S1|6PGL_RHIME 6-phosphogluconolactonase OS=Rhizobium meliloti (strain 1021) GN=pgl PE=3 SV=2 7 223 1.0E-13
sp|Q9X0N8|6PGL_THEMA 6-phosphogluconolactonase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=pgl PE=1 SV=1 41 242 1.0E-13
sp|Q54CJ3|6PGL_DICDI Probable 6-phosphogluconolactonase OS=Dictyostelium discoideum GN=pgl PE=3 SV=1 24 213 6.0E-11
sp|O25730|6PGL_HELPY 6-phosphogluconolactonase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=pgl PE=3 SV=1 8 216 3.0E-09
sp|Q9X2N2|6PGL_PSEAE 6-phosphogluconolactonase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=pgl PE=3 SV=2 18 224 6.0E-09
sp|Q9ZKB1|6PGL_HELPJ 6-phosphogluconolactonase OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=pgl PE=3 SV=1 8 216 2.0E-08
sp|Q9EV79|6PGL_PSEPU 6-phosphogluconolactonase OS=Pseudomonas putida GN=pgl PE=3 SV=1 7 222 2.0E-08
sp|Q9PEG5|6PGL_XYLFA 6-phosphogluconolactonase OS=Xylella fastidiosa (strain 9a5c) GN=pgl PE=3 SV=1 21 222 2.0E-06
sp|Q87EG7|6PGL_XYLFT 6-phosphogluconolactonase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=pgl PE=3 SV=1 21 222 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005975 carbohydrate metabolic process Yes
GO:0008152 metabolic process No
GO:0071704 organic substance metabolic process No
GO:0008150 biological_process No
GO:0044238 primary metabolic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2764
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2195
Ophiocordyceps australis map64 (Brazil) OphauB2|5156
Ophiocordyceps camponoti-floridani Ophcf2|06506
Ophiocordyceps camponoti-rufipedis Ophun1|216 (this protein)
Ophiocordyceps kimflemingae Ophio5|4461
Ophiocordyceps subramaniannii Hirsu2|4401

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|216
MAKSQPNLYAFPDVDALAPALRAYILQSQTAAFDRHGTFKVAVSGGSLPKTLAAALLDCPSIDWSRWEIFFADER
AVPLDDPESNYALVKKDMLDRLPKDTAQPAVHPINVDLLEEGVQAVADAYERTLVASFASRDSVRLPIFDLVLLG
CGPDGHTCSLFPGHALLRETDAWVAPIEDSPKPPPRRITLTLPVVTHAIRAAFVATGASKRDVMKKIFDSPDEQL
PCNLVNAAAGDRCSWFVDEAAVEGVAFPRKAFL*
Coding >Ophun1|216
ATGGCCAAGTCACAGCCCAACCTATACGCCTTCCCCGACGTCGACGCCCTCGCCCCCGCCCTCCGCGCCTACATC
CTCCAAAGCCAAACCGCCGCCTTCGACCGCCACGGCACCTTCAAGGTAGCCGTCTCAGGCGGATCGCTGCCCAAG
ACGCTGGCAGCCGCCCTCCTCGACTGCCCGTCCATCGACTGGTCCCGGTGGGAAATCTTCTTCGCCGACGAGCGC
GCCGTTCCCCTCGACGACCCCGAATCCAACTACGCGCTCGTCAAGAAGGACATGTTAGATCGTCTGCCCAAGGAC
ACAGCCCAGCCAGCCGTCCACCCCATCAACGTCGACCTCCTCGAAGAAGGCGTCCAGGCCGTGGCAGACGCTTAC
GAGAGGACCCTAGTGGCCAGCTTCGCAAGCCGCGACTCCGTCCGCCTCCCCATCTTCGACCTCGTCCTCCTCGGA
TGCGGACCCGACGGACACACCTGCTCCCTCTTCCCCGGCCACGCCCTCCTCCGCGAGACAGACGCCTGGGTGGCG
CCCATCGAAGACTCGCCCAAGCCGCCTCCCCGGCGGATCACGCTGACGCTCCCCGTCGTGACGCACGCTATTCGT
GCCGCCTTTGTCGCTACCGGCGCCTCGAAGCGTGACGTCATGAAGAAGATCTTTGACTCGCCGGACGAGCAGCTC
CCCTGCAATCTCGTCAATGCCGCCGCCGGTGATCGCTGCAGCTGGTTCGTTGACGAGGCTGCCGTTGAGGGCGTT
GCTTTTCCGAGAAAGGCCTTTCTGTAG
Transcript >Ophun1|216
ATGGCCAAGTCACAGCCCAACCTATACGCCTTCCCCGACGTCGACGCCCTCGCCCCCGCCCTCCGCGCCTACATC
CTCCAAAGCCAAACCGCCGCCTTCGACCGCCACGGCACCTTCAAGGTAGCCGTCTCAGGCGGATCGCTGCCCAAG
ACGCTGGCAGCCGCCCTCCTCGACTGCCCGTCCATCGACTGGTCCCGGTGGGAAATCTTCTTCGCCGACGAGCGC
GCCGTTCCCCTCGACGACCCCGAATCCAACTACGCGCTCGTCAAGAAGGACATGTTAGATCGTCTGCCCAAGGAC
ACAGCCCAGCCAGCCGTCCACCCCATCAACGTCGACCTCCTCGAAGAAGGCGTCCAGGCCGTGGCAGACGCTTAC
GAGAGGACCCTAGTGGCCAGCTTCGCAAGCCGCGACTCCGTCCGCCTCCCCATCTTCGACCTCGTCCTCCTCGGA
TGCGGACCCGACGGACACACCTGCTCCCTCTTCCCCGGCCACGCCCTCCTCCGCGAGACAGACGCCTGGGTGGCG
CCCATCGAAGACTCGCCCAAGCCGCCTCCCCGGCGGATCACGCTGACGCTCCCCGTCGTGACGCACGCTATTCGT
GCCGCCTTTGTCGCTACCGGCGCCTCGAAGCGTGACGTCATGAAGAAGATCTTTGACTCGCCGGACGAGCAGCTC
CCCTGCAATCTCGTCAATGCCGCCGCCGGTGATCGCTGCAGCTGGTTCGTTGACGAGGCTGCCGTTGAGGGCGTT
GCTTTTCCGAGAAAGGCCTTTCTGTAG
Gene >Ophun1|216
ATGGCCAAGTCACAGCCCAACCTATACGCCTTCCCCGACGTCGACGCCCTCGCCCCCGCCCTCCGCGCCTACATC
CTCCAAAGCCAAACCGCCGCCTTCGACCGCCACGGCACCTTCAAGGTAGCCGTCTCAGGCGGATCGCTGCCCAAG
ACGCTGGCAGCCGCCCTCCTCGACTGCCCGTCCATCGACTGGTCCCGGTGGGAAATCTTCTTCGCCGACGAGCGC
GCCGTTCCCCTCGACGACCCCGAATCCAACTACGCGCTCGTCAAGAAGGACATGTTAGATCGTCTGCCCAAGGAC
ACAGCCCAGCCAGCCGTCCACCCCATCAACGTCGACCTCCTCGAAGAAGGCGTCCAGGCCGTGGCAGACGCTTAC
GAGAGGACCCTAGTGGCCAGCTTCGCAAGCCGCGACTCCGTCCGCCTCCCCATCTTCGACCTCGTCCTCCTCGGA
TGCGGACCCGACGGACACACCTGCTCCCTCTTCCCCGGCCACGCCCTCCTCCGCGAGACAGACGCCTGGGTGGCG
CCCATCGAAGACTCGCCCAAGCCGCCTCCCCGGCGGATCACGCTGACGCTCCCCGTCGTGACGCACGCTATTCGT
GCCGCCTTTGTCGCTACCGGCGCCTCGAAGCGTGACGTCATGAAGAAGATCTTTGACTCGCCGGACGAGCAGCTC
CCCTGCAATCTCGTCAATGCCGCCGCCGGTGATCGCTGCAGCTGGTTCGTTGACGAGGCTGCCGTTGAGGGCGTT
GCTTTTCCGAGAAAGGCCTTTCTGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail