Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2157
Gene name
LocationContig_2000:246..913
Strand+
Gene length (bp)667
Transcript length (bp)606
Coding sequence length (bp)606
Protein length (aa) 202

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00271 Helicase_C Helicase conserved C-terminal domain 6.4E-14 57 155

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q06683|IRC3_YEAST Putative ATP-dependent helicase IRC3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IRC3 PE=1 SV=1 1 189 4.0E-56
sp|Q1MTR1|IRC3_SCHPO Putative mitochondrial ATP-dependent helicase irc3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=irc3 PE=3 SV=2 1 189 2.0E-46
sp|P33919|YEJH_ECOLI Uncharacterized protein YejH OS=Escherichia coli (strain K12) GN=yejH PE=3 SV=2 20 170 4.0E-21
sp|Q914K8|Y022_SIFVH Putative helicase 22 OS=Sulfolobus islandicus filamentous virus (isolate Iceland/Hveragerdi) GN=SIFV0022 PE=3 SV=1 65 170 1.0E-11
sp|P24125|V51K_BPL79 51.5 kDa protein OS=Lactococcus phage (isolate 7-9) PE=3 SV=1 1 159 2.0E-11
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q06683|IRC3_YEAST Putative ATP-dependent helicase IRC3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IRC3 PE=1 SV=1 1 189 4.0E-56
sp|Q1MTR1|IRC3_SCHPO Putative mitochondrial ATP-dependent helicase irc3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=irc3 PE=3 SV=2 1 189 2.0E-46
sp|P33919|YEJH_ECOLI Uncharacterized protein YejH OS=Escherichia coli (strain K12) GN=yejH PE=3 SV=2 20 170 4.0E-21
sp|Q914K8|Y022_SIFVH Putative helicase 22 OS=Sulfolobus islandicus filamentous virus (isolate Iceland/Hveragerdi) GN=SIFV0022 PE=3 SV=1 65 170 1.0E-11
sp|P24125|V51K_BPL79 51.5 kDa protein OS=Lactococcus phage (isolate 7-9) PE=3 SV=1 1 159 2.0E-11
sp|Q837R9|UVRB_ENTFA UvrABC system protein B OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=uvrB PE=3 SV=1 48 178 6.0E-09
sp|Q8DHC6|UVRB_THEEB UvrABC system protein B OS=Thermosynechococcus elongatus (strain BP-1) GN=uvrB PE=3 SV=1 77 178 9.0E-09
sp|Q7NJH7|UVRB_GLOVI UvrABC system protein B OS=Gloeobacter violaceus (strain PCC 7421) GN=uvrB PE=3 SV=1 57 178 1.0E-08
sp|Q3AFF4|UVRB_CARHZ UvrABC system protein B OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=uvrB PE=3 SV=1 57 178 1.0E-08
sp|A3CNJ9|UVRB_STRSV UvrABC system protein B OS=Streptococcus sanguinis (strain SK36) GN=uvrB PE=3 SV=1 56 178 2.0E-08
sp|C1CKX8|UVRB_STRZP UvrABC system protein B OS=Streptococcus pneumoniae (strain P1031) GN=uvrB PE=3 SV=1 56 178 2.0E-08
sp|C1CEJ5|UVRB_STRZJ UvrABC system protein B OS=Streptococcus pneumoniae (strain JJA) GN=uvrB PE=3 SV=1 56 178 2.0E-08
sp|Q8DPK7|UVRB_STRR6 UvrABC system protein B OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=uvrB PE=3 SV=1 56 178 2.0E-08
sp|B2IPP4|UVRB_STRPS UvrABC system protein B OS=Streptococcus pneumoniae (strain CGSP14) GN=uvrB PE=3 SV=1 56 178 2.0E-08
sp|Q54986|UVRB_STRPN UvrABC system protein B OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=uvrB PE=3 SV=2 56 178 2.0E-08
sp|B8ZJQ9|UVRB_STRPJ UvrABC system protein B OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=uvrB PE=3 SV=1 56 178 2.0E-08
sp|Q04K81|UVRB_STRP2 UvrABC system protein B OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=uvrB PE=3 SV=1 56 178 2.0E-08
sp|C1CR65|UVRB_STRZT UvrABC system protein B OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=uvrB PE=3 SV=1 56 178 2.0E-08
sp|B1IC35|UVRB_STRPI UvrABC system protein B OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=uvrB PE=3 SV=1 56 178 2.0E-08
sp|C1C7L7|UVRB_STRP7 UvrABC system protein B OS=Streptococcus pneumoniae (strain 70585) GN=uvrB PE=3 SV=1 56 178 2.0E-08
sp|B5E4X3|UVRB_STRP4 UvrABC system protein B OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=uvrB PE=3 SV=1 56 178 2.0E-08
sp|A8AX17|UVRB_STRGC UvrABC system protein B OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=uvrB PE=3 SV=1 56 178 2.0E-08
sp|Q9K6X9|UVRB_BACHD UvrABC system protein B OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=uvrB PE=3 SV=1 45 178 2.0E-08
sp|Q2JN87|UVRB_SYNJB UvrABC system protein B OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=uvrB PE=3 SV=1 77 178 3.0E-08
sp|Q55170|UVRB_SYNY3 UvrABC system protein B OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=uvrB PE=3 SV=1 77 178 3.0E-08
sp|Q2NGT1|UVRB_METST UvrABC system protein B OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=uvrB PE=3 SV=1 60 178 3.0E-08
sp|P08956|T1RK_ECOLI Type I restriction enzyme EcoKI R protein OS=Escherichia coli (strain K12) GN=hsdR PE=3 SV=3 30 173 3.0E-08
sp|A5UNK6|UVRB_METS3 UvrABC system protein B OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=uvrB PE=3 SV=1 57 178 4.0E-08
sp|Q2JRR3|UVRB_SYNJA UvrABC system protein B OS=Synechococcus sp. (strain JA-3-3Ab) GN=uvrB PE=3 SV=1 77 178 4.0E-08
sp|Q5WDG7|UVRB_BACSK UvrABC system protein B OS=Bacillus clausii (strain KSM-K16) GN=uvrB PE=3 SV=1 77 178 4.0E-08
sp|P57844|UVRB_PASMU UvrABC system protein B OS=Pasteurella multocida (strain Pm70) GN=uvrB PE=3 SV=1 57 178 9.0E-08
sp|Q6AF52|UVRB_LEIXX UvrABC system protein B OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=uvrB PE=3 SV=1 56 178 1.0E-07
sp|A7I3X8|UVRB_CAMHC UvrABC system protein B OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=uvrB PE=3 SV=1 47 178 1.0E-07
sp|B2S264|UVRB_TREPS UvrABC system protein B OS=Treponema pallidum subsp. pallidum (strain SS14) GN=uvrB PE=3 SV=1 34 158 1.0E-07
sp|O83154|UVRB_TREPA UvrABC system protein B OS=Treponema pallidum (strain Nichols) GN=uvrB PE=3 SV=1 34 158 1.0E-07
sp|O26542|UVRB_METTH UvrABC system protein B OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=uvrB PE=3 SV=1 77 178 1.0E-07
sp|B0RES6|UVRB_CLAMS UvrABC system protein B OS=Clavibacter michiganensis subsp. sepedonicus (strain ATCC 33113 / DSM 20744 / JCM 9667 / LMG 2889 / C-1) GN=uvrB PE=3 SV=1 77 189 1.0E-07
sp|Q74K90|UVRB_LACJO UvrABC system protein B OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=uvrB PE=3 SV=1 77 178 1.0E-07
sp|Q042E2|UVRB_LACGA UvrABC system protein B OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=uvrB PE=3 SV=1 77 178 1.0E-07
sp|A5CRU3|UVRB_CLAM3 UvrABC system protein B OS=Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382) GN=uvrB PE=3 SV=1 77 189 1.0E-07
sp|Q73MY7|UVRB_TREDE UvrABC system protein B OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=uvrB PE=3 SV=1 64 159 1.0E-07
sp|Q8RGR2|UVRB_FUSNN UvrABC system protein B OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=uvrB PE=3 SV=1 57 178 1.0E-07
sp|P37954|UVRB_BACSU UvrABC system protein B OS=Bacillus subtilis (strain 168) GN=uvrB PE=1 SV=2 56 178 2.0E-07
sp|B9DSH1|UVRB_STRU0 UvrABC system protein B OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=uvrB PE=3 SV=1 77 178 2.0E-07
sp|B8HQA9|UVRB_CYAP4 UvrABC system protein B OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=uvrB PE=3 SV=1 61 178 2.0E-07
sp|Q11Z64|UVRB_CYTH3 UvrABC system protein B OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=uvrB PE=3 SV=1 77 178 2.0E-07
sp|Q72XV1|UVRB_BACC1 UvrABC system protein B OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=uvrB PE=3 SV=1 34 178 3.0E-07
sp|Q4QJX4|UVRB_HAEI8 UvrABC system protein B OS=Haemophilus influenzae (strain 86-028NP) GN=uvrB PE=3 SV=1 34 178 3.0E-07
sp|P45125|UVRB_HAEIN UvrABC system protein B OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=uvrB PE=3 SV=1 34 178 3.0E-07
sp|A1STV6|UVRB_PSYIN UvrABC system protein B OS=Psychromonas ingrahamii (strain 37) GN=uvrB PE=3 SV=1 61 178 4.0E-07
sp|Q8ENJ5|UVRB_OCEIH UvrABC system protein B OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=uvrB PE=3 SV=1 77 178 4.0E-07
sp|Q65ST2|UVRB_MANSM UvrABC system protein B OS=Mannheimia succiniciproducens (strain MBEL55E) GN=uvrB PE=3 SV=1 34 178 5.0E-07
sp|Q38YA4|UVRB_LACSS UvrABC system protein B OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=uvrB PE=3 SV=1 77 178 5.0E-07
sp|Q67T57|UVRB_SYMTH UvrABC system protein B OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=uvrB PE=3 SV=1 56 178 6.0E-07
sp|B0CE09|UVRB_ACAM1 UvrABC system protein B OS=Acaryochloris marina (strain MBIC 11017) GN=uvrB PE=3 SV=1 57 178 6.0E-07
sp|Q5KVB5|UVRB_GEOKA UvrABC system protein B OS=Geobacillus kaustophilus (strain HTA426) GN=uvrB PE=3 SV=1 62 178 6.0E-07
sp|A6SCT6|DBP3_BOTFB ATP-dependent RNA helicase dbp3 OS=Botryotinia fuckeliana (strain B05.10) GN=dbp3 PE=3 SV=1 28 154 6.0E-07
sp|Q5HVA1|UVRB_CAMJR UvrABC system protein B OS=Campylobacter jejuni (strain RM1221) GN=uvrB PE=3 SV=1 77 178 7.0E-07
sp|Q9PPM7|UVRB_CAMJE UvrABC system protein B OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=uvrB PE=3 SV=1 77 178 7.0E-07
sp|Q6HBC2|UVRB_BACHK UvrABC system protein B OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=uvrB PE=3 SV=1 34 159 7.0E-07
sp|Q81X47|UVRB_BACAN UvrABC system protein B OS=Bacillus anthracis GN=uvrB PE=3 SV=1 34 159 7.0E-07
sp|Q5M3D5|UVRB_STRT2 UvrABC system protein B OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=uvrB PE=3 SV=1 48 178 7.0E-07
sp|Q5LYS1|UVRB_STRT1 UvrABC system protein B OS=Streptococcus thermophilus (strain CNRZ 1066) GN=uvrB PE=3 SV=1 48 178 7.0E-07
sp|B2A713|UVRB_NATTJ UvrABC system protein B OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=uvrB PE=3 SV=1 53 159 7.0E-07
sp|Q631I6|UVRB_BACCZ UvrABC system protein B OS=Bacillus cereus (strain ZK / E33L) GN=uvrB PE=3 SV=1 34 159 7.0E-07
sp|Q03JK4|UVRB_STRTD UvrABC system protein B OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=uvrB PE=3 SV=1 48 178 7.0E-07
sp|P56981|UVRB_BACCA UvrABC system protein B OS=Bacillus caldotenax GN=uvrB PE=1 SV=2 62 178 7.0E-07
sp|Q9NR30|DDX21_HUMAN Nucleolar RNA helicase 2 OS=Homo sapiens GN=DDX21 PE=1 SV=5 64 154 8.0E-07
sp|Q88YI8|UVRB_LACPL UvrABC system protein B OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=uvrB PE=3 SV=1 36 178 8.0E-07
sp|Q3B8Q2|IF4A3_RAT Eukaryotic initiation factor 4A-III OS=Rattus norvegicus GN=Eif4a3 PE=1 SV=1 63 154 9.0E-07
sp|A6M931|IF4A3_PIG Eukaryotic initiation factor 4A-III OS=Sus scrofa GN=EIF4A3 PE=2 SV=1 63 154 9.0E-07
sp|Q2NL22|IF4A3_BOVIN Eukaryotic initiation factor 4A-III OS=Bos taurus GN=EIF4A3 PE=2 SV=3 63 154 9.0E-07
sp|Q91VC3|IF4A3_MOUSE Eukaryotic initiation factor 4A-III OS=Mus musculus GN=Eif4a3 PE=1 SV=3 63 154 9.0E-07
sp|B3WCQ5|UVRB_LACCB UvrABC system protein B OS=Lactobacillus casei (strain BL23) GN=uvrB PE=3 SV=1 77 178 9.0E-07
sp|Q03AL7|UVRB_LACC3 UvrABC system protein B OS=Lactobacillus casei (strain ATCC 334) GN=uvrB PE=3 SV=1 77 178 9.0E-07
sp|Q4R3Q1|IF4A3_MACFA Eukaryotic initiation factor 4A-III OS=Macaca fascicularis GN=EIF4A3 PE=2 SV=3 63 154 9.0E-07
sp|P38919|IF4A3_HUMAN Eukaryotic initiation factor 4A-III OS=Homo sapiens GN=EIF4A3 PE=1 SV=4 63 154 9.0E-07
sp|A7EYW0|DBP3_SCLS1 ATP-dependent RNA helicase dbp3 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=dbp3 PE=3 SV=2 28 134 9.0E-07
sp|B3EFX1|UVRB_CHLL2 UvrABC system protein B OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=uvrB PE=3 SV=1 77 158 9.0E-07
sp|A7Z985|UVRB_BACMF UvrABC system protein B OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=uvrB PE=3 SV=1 56 178 1.0E-06
sp|B5XLX7|UVRB_STRPZ UvrABC system protein B OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=uvrB PE=3 SV=1 48 178 1.0E-06
sp|Q99ZA5|UVRB_STRP1 UvrABC system protein B OS=Streptococcus pyogenes serotype M1 GN=uvrB PE=3 SV=1 48 178 1.0E-06
sp|Q5ZM36|IF4A3_CHICK Eukaryotic initiation factor 4A-III OS=Gallus gallus GN=EIF4A3 PE=2 SV=1 63 154 1.0E-06
sp|Q65ED8|UVRB_BACLD UvrABC system protein B OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=uvrB PE=3 SV=1 77 178 1.0E-06
sp|B5FZY7|IF4A3_TAEGU Eukaryotic initiation factor 4A-III OS=Taeniopygia guttata GN=EIF4A3 PE=2 SV=1 63 154 1.0E-06
sp|Q815I3|UVRB_BACCR UvrABC system protein B OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=uvrB PE=3 SV=1 34 159 1.0E-06
sp|O42226|I4A3B_XENLA Eukaryotic initiation factor 4A-III-B OS=Xenopus laevis GN=eif4a3-b PE=2 SV=1 63 154 1.0E-06
sp|Q0IE10|UVRB_SYNS3 UvrABC system protein B OS=Synechococcus sp. (strain CC9311) GN=uvrB PE=3 SV=1 57 178 1.0E-06
sp|B7ZTW1|IF4A3_XENTR Eukaryotic initiation factor 4A-III OS=Xenopus tropicalis GN=eif4a3 PE=2 SV=1 63 154 1.0E-06
sp|Q1J665|UVRB_STRPF UvrABC system protein B OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=uvrB PE=3 SV=1 48 178 1.0E-06
sp|B5DG42|IF4A3_SALSA Eukaryotic initiation factor 4A-III OS=Salmo salar GN=eif4a3 PE=2 SV=1 63 154 1.0E-06
sp|Q5U526|I4A3A_XENLA Eukaryotic initiation factor 4A-III-A OS=Xenopus laevis GN=eif4a3-a PE=2 SV=1 63 154 1.0E-06
sp|A4W1F7|UVRB_STRS2 UvrABC system protein B OS=Streptococcus suis (strain 98HAH33) GN=uvrB PE=3 SV=1 56 165 1.0E-06
sp|Q8R8M4|UVRB_CALS4 UvrABC system protein B OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=uvrB PE=3 SV=1 77 178 1.0E-06
sp|Q8CWX7|UVRB_STRMU UvrABC system protein B OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=uvrB PE=3 SV=1 57 165 1.0E-06
sp|Q829Y6|UVRB_STRAW UvrABC system protein B OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=uvrB PE=3 SV=1 77 178 2.0E-06
sp|B0SLS0|UVRB_LEPBP UvrABC system protein B OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=uvrB PE=3 SV=1 46 178 2.0E-06
sp|B0SDE2|UVRB_LEPBA UvrABC system protein B OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=uvrB PE=3 SV=1 46 178 2.0E-06
sp|Q5N3H1|UVRB_SYNP6 UvrABC system protein B OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=uvrB PE=3 SV=1 77 178 2.0E-06
sp|Q31QS4|UVRB_SYNE7 UvrABC system protein B OS=Synechococcus elongatus (strain PCC 7942) GN=uvrB PE=3 SV=1 77 178 2.0E-06
sp|O33395|UVRB_NEIMB UvrABC system protein B OS=Neisseria meningitidis serogroup B (strain MC58) GN=uvrB PE=3 SV=3 51 178 2.0E-06
sp|P56996|UVRB_NEIMA UvrABC system protein B OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=uvrB PE=3 SV=1 51 178 2.0E-06
sp|Q9HMT9|UVRB_HALSA UvrABC system protein B OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=uvrB PE=3 SV=1 36 178 2.0E-06
sp|C5BV49|UVRB_BEUC1 UvrABC system protein B OS=Beutenbergia cavernae (strain ATCC BAA-8 / DSM 12333 / NBRC 16432) GN=uvrB PE=3 SV=1 56 189 2.0E-06
sp|A0PP48|UVRB_MYCUA UvrABC system protein B OS=Mycobacterium ulcerans (strain Agy99) GN=uvrB PE=3 SV=1 57 178 2.0E-06
sp|P9WFC7|UVRB_MYCTU UvrABC system protein B OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=uvrB PE=1 SV=2 57 178 2.0E-06
sp|P9WFC6|UVRB_MYCTO UvrABC system protein B OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=uvrB PE=3 SV=2 57 178 2.0E-06
sp|P67423|UVRB_MYCBO UvrABC system protein B OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=uvrB PE=3 SV=2 57 178 2.0E-06
sp|B7KC96|UVRB_CYAP7 UvrABC system protein B OS=Cyanothece sp. (strain PCC 7424) GN=uvrB PE=3 SV=1 77 171 2.0E-06
sp|Q8CK11|UVRB_STRCO UvrABC system protein B OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=uvrB PE=3 SV=1 77 178 2.0E-06
sp|C0MDC6|UVRB_STRS7 UvrABC system protein B OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=uvrB PE=3 SV=1 77 178 2.0E-06
sp|B4U3P4|UVRB_STREM UvrABC system protein B OS=Streptococcus equi subsp. zooepidemicus (strain MGCS10565) GN=uvrB PE=3 SV=1 77 178 2.0E-06
sp|Q031G7|UVRB_LACLS UvrABC system protein B OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=uvrB PE=3 SV=1 77 165 2.0E-06
sp|A2RIP3|UVRB_LACLM UvrABC system protein B OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=uvrB PE=3 SV=1 77 165 2.0E-06
sp|Q9CI06|UVRB_LACLA UvrABC system protein B OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=uvrB PE=3 SV=1 77 165 2.0E-06
sp|B5YJW4|UVRB_THEYD UvrABC system protein B OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=uvrB PE=3 SV=1 57 154 3.0E-06
sp|B9MS82|UVRB_CALBD UvrABC system protein B OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=uvrB PE=3 SV=1 57 178 3.0E-06
sp|C0MBD7|UVRB_STRE4 UvrABC system protein B OS=Streptococcus equi subsp. equi (strain 4047) GN=uvrB PE=3 SV=1 77 178 3.0E-06
sp|Q8DYL6|UVRB_STRA5 UvrABC system protein B OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=uvrB PE=3 SV=1 77 178 3.0E-06
sp|Q8E471|UVRB_STRA3 UvrABC system protein B OS=Streptococcus agalactiae serotype III (strain NEM316) GN=uvrB PE=3 SV=1 77 178 3.0E-06
sp|Q3K051|UVRB_STRA1 UvrABC system protein B OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=uvrB PE=3 SV=1 77 178 3.0E-06
sp|A3LQ01|DED1_PICST ATP-dependent RNA helicase DED1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=DED1 PE=3 SV=3 55 154 3.0E-06
sp|Q7VFX7|UVRB_HELHP UvrABC system protein B OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=uvrB PE=3 SV=1 56 178 3.0E-06
sp|Q50939|UVRB_NEIGO UvrABC system protein B OS=Neisseria gonorrhoeae GN=uvrB PE=3 SV=1 51 178 3.0E-06
sp|Q5F931|UVRB_NEIG1 UvrABC system protein B OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=uvrB PE=3 SV=1 51 178 3.0E-06
sp|Q6BU54|DED1_DEBHA ATP-dependent RNA helicase DED1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DED1 PE=3 SV=1 58 154 3.0E-06
sp|A5DQS0|DED1_PICGU ATP-dependent RNA helicase DED1 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=DED1 PE=3 SV=3 58 154 3.0E-06
sp|P57991|UVRB_MYCLE UvrABC system protein B OS=Mycobacterium leprae (strain TN) GN=uvrB PE=3 SV=1 57 178 3.0E-06
sp|A0RPB3|UVRB_CAMFF UvrABC system protein B OS=Campylobacter fetus subsp. fetus (strain 82-40) GN=uvrB PE=3 SV=1 77 178 3.0E-06
sp|Q12TR7|UVRB_METBU UvrABC system protein B OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=uvrB PE=3 SV=1 45 158 3.0E-06
sp|Q03SM9|UVRB_LACBA UvrABC system protein B OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=uvrB PE=3 SV=1 64 178 3.0E-06
sp|Q7VLL3|UVRB_HAEDU UvrABC system protein B OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=uvrB PE=3 SV=1 77 178 4.0E-06
sp|Q890X8|UVRB_CLOTE UvrABC system protein B OS=Clostridium tetani (strain Massachusetts / E88) GN=uvrB PE=3 SV=1 77 178 4.0E-06
sp|Q6A9K7|UVRB_PROAC UvrABC system protein B OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=uvrB PE=3 SV=1 77 178 4.0E-06
sp|A3N031|UVRB_ACTP2 UvrABC system protein B OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=uvrB PE=3 SV=1 77 178 4.0E-06
sp|Q5FL61|UVRB_LACAC UvrABC system protein B OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=uvrB PE=3 SV=1 77 178 4.0E-06
sp|C3KV20|UVRB_CLOB6 UvrABC system protein B OS=Clostridium botulinum (strain 657 / Type Ba4) GN=uvrB PE=3 SV=1 77 159 4.0E-06
sp|B1L280|UVRB_CLOBM UvrABC system protein B OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=uvrB PE=3 SV=1 77 159 4.0E-06
sp|C1FMK5|UVRB_CLOBJ UvrABC system protein B OS=Clostridium botulinum (strain Kyoto / Type A2) GN=uvrB PE=3 SV=1 77 159 4.0E-06
sp|P0DH39|UVRB_STRPQ UvrABC system protein B OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=uvrB PE=3 SV=1 77 178 4.0E-06
sp|Q48SZ1|UVRB_STRPM UvrABC system protein B OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=uvrB PE=3 SV=1 77 178 4.0E-06
sp|A2RE43|UVRB_STRPG UvrABC system protein B OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=uvrB PE=3 SV=1 77 178 4.0E-06
sp|Q1JGE8|UVRB_STRPD UvrABC system protein B OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=uvrB PE=3 SV=1 77 178 4.0E-06
sp|Q1JLB5|UVRB_STRPC UvrABC system protein B OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=uvrB PE=3 SV=1 77 178 4.0E-06
sp|Q1JBD1|UVRB_STRPB UvrABC system protein B OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=uvrB PE=3 SV=1 77 178 4.0E-06
sp|Q8P0J7|UVRB_STRP8 UvrABC system protein B OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=uvrB PE=3 SV=1 77 178 4.0E-06
sp|Q5XBN4|UVRB_STRP6 UvrABC system protein B OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=uvrB PE=3 SV=1 77 178 4.0E-06
sp|P0DH38|UVRB_STRP3 UvrABC system protein B OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=uvrB PE=3 SV=1 77 178 4.0E-06
sp|A7GIY3|UVRB_CLOBL UvrABC system protein B OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=uvrB PE=3 SV=1 77 159 4.0E-06
sp|B1IFX3|UVRB_CLOBK UvrABC system protein B OS=Clostridium botulinum (strain Okra / Type B1) GN=uvrB PE=3 SV=1 77 159 4.0E-06
sp|A7FYY1|UVRB_CLOB1 UvrABC system protein B OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=uvrB PE=3 SV=1 77 159 4.0E-06
sp|P42305|DBPA_BACSU ATP-dependent RNA helicase DbpA OS=Bacillus subtilis (strain 168) GN=dbpA PE=1 SV=2 23 134 4.0E-06
sp|A4XKY5|UVRB_CALS8 UvrABC system protein B OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=uvrB PE=3 SV=1 57 178 4.0E-06
sp|Q98I01|UVRB_RHILO UvrABC system protein B OS=Rhizobium loti (strain MAFF303099) GN=uvrB PE=3 SV=1 64 178 4.0E-06
sp|Q7V9M1|UVRB_PROMA UvrABC system protein B OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=uvrB PE=3 SV=1 57 178 5.0E-06
sp|Q47QN5|UVRB_THEFY UvrABC system protein B OS=Thermobifida fusca (strain YX) GN=uvrB PE=3 SV=1 46 178 6.0E-06
sp|Q5X0E6|UVRB_LEGPL UvrABC system protein B OS=Legionella pneumophila (strain Lens) GN=uvrB PE=3 SV=1 77 178 7.0E-06
sp|A5DZE6|DED1_LODEL ATP-dependent RNA helicase DED1 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=DED1 PE=3 SV=1 64 154 7.0E-06
sp|Q7TV80|UVRB_PROMM UvrABC system protein B OS=Prochlorococcus marinus (strain MIT 9313) GN=uvrB PE=3 SV=1 57 178 8.0E-06
sp|Q8YXS9|UVRB_NOSS1 UvrABC system protein B OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=uvrB PE=3 SV=1 77 178 8.0E-06
sp|Q47EI2|UVRB_DECAR UvrABC system protein B OS=Dechloromonas aromatica (strain RCB) GN=uvrB PE=3 SV=1 77 178 9.0E-06
sp|A5I9P3|UVRB_LEGPC UvrABC system protein B OS=Legionella pneumophila (strain Corby) GN=uvrB PE=3 SV=1 77 178 1.0E-05
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2520
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4430
Ophiocordyceps australis map64 (Brazil) OphauB2|1165
Ophiocordyceps camponoti-floridani Ophcf2|04156
Ophiocordyceps camponoti-rufipedis Ophun1|2157 (this protein)
Ophiocordyceps kimflemingae Ophio5|3013
Ophiocordyceps subramaniannii Hirsu2|3685

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2157
MISDKWLSDVLFTTVRSSADLAHVKRGAFGDFNTGDLSNAVNTREVNELTVRSWMAKASDRKSTLVFCVDLEHVR
GLTDAFRQVGLDARYVTGETPKLERSETLDAFKSGGFPILVNCGVFTEGTDIPNIDCIVLARPTRSRNLLVQMIG
RGMRLSPGKENCHVIDLVSSLQTGIVTTPTLFGLDPSELTATQPASEKQPS*
Coding >Ophun1|2157
ATGATATCCGACAAGTGGCTCTCCGACGTCCTCTTCACCACCGTCCGCTCCTCCGCAGATCTAGCCCACGTCAAG
CGCGGCGCCTTTGGAGATTTCAACACAGGCGACCTCTCCAACGCCGTCAACACGCGCGAAGTCAACGAGCTCACA
GTCCGAAGCTGGATGGCCAAAGCCTCGGATCGCAAGTCAACCCTCGTCTTCTGCGTCGATCTGGAGCACGTCCGC
GGCCTCACCGACGCCTTCCGTCAGGTCGGCCTCGACGCCCGCTACGTAACCGGCGAGACACCCAAGCTCGAACGC
AGCGAAACGCTCGACGCCTTCAAGAGCGGCGGCTTCCCCATCCTCGTCAACTGCGGCGTCTTCACCGAGGGAACC
GACATCCCGAACATCGACTGCATCGTCCTCGCCCGTCCCACACGCTCCCGCAACCTCCTAGTCCAGATGATCGGT
CGAGGCATGCGTCTCTCCCCCGGCAAAGAAAACTGCCACGTCATAGACCTAGTCTCCAGCCTTCAGACCGGCATC
GTCACCACCCCAACCCTCTTCGGCCTCGATCCCAGCGAACTAACCGCGACGCAGCCCGCATCCGAGAAGCAACCC
TCTTAG
Transcript >Ophun1|2157
ATGATATCCGACAAGTGGCTCTCCGACGTCCTCTTCACCACCGTCCGCTCCTCCGCAGATCTAGCCCACGTCAAG
CGCGGCGCCTTTGGAGATTTCAACACAGGCGACCTCTCCAACGCCGTCAACACGCGCGAAGTCAACGAGCTCACA
GTCCGAAGCTGGATGGCCAAAGCCTCGGATCGCAAGTCAACCCTCGTCTTCTGCGTCGATCTGGAGCACGTCCGC
GGCCTCACCGACGCCTTCCGTCAGGTCGGCCTCGACGCCCGCTACGTAACCGGCGAGACACCCAAGCTCGAACGC
AGCGAAACGCTCGACGCCTTCAAGAGCGGCGGCTTCCCCATCCTCGTCAACTGCGGCGTCTTCACCGAGGGAACC
GACATCCCGAACATCGACTGCATCGTCCTCGCCCGTCCCACACGCTCCCGCAACCTCCTAGTCCAGATGATCGGT
CGAGGCATGCGTCTCTCCCCCGGCAAAGAAAACTGCCACGTCATAGACCTAGTCTCCAGCCTTCAGACCGGCATC
GTCACCACCCCAACCCTCTTCGGCCTCGATCCCAGCGAACTAACCGCGACGCAGCCCGCATCCGAGAAGCAACCC
TCTTAG
Gene >Ophun1|2157
ATGATATCCGACAAGTGGCTCTCCGACGTCCTCTTCACCACCGTCCGCTCCTCCGCAGATCTAGCCCACGTCAAG
CGCGGCGCCTTTGGAGATTTCAACACAGGCGACCTCTCCAACGCCGTCAACACGCGCGAAGTCAACGAGCTCACA
GTCCGAAGCTGGATGGCCAAAGCCTCGGATCGCAAGTCAACCCTCGTCTTCTGCGTCGATCTGGAGCACGTCCGC
GGCCTCACCGACGCCTTCCGTCAGGTCGGCCTCGACGCCCGCTACGTAACCGGCGAGACACCCAAGCTCGAACGC
AGCGAAACGCTCGACGCCTTCAAGAGCGGCGGCTTCCCCATCCTCGTCAACTGCGGCGTCTTCACCGAGGGAACC
GACATCCCGAACATCGACTGCATCGTCCTCGCCCGTCCCACACGCTCCCGCAACCTCCTAGTCCAGATGATCGGT
CGAGGCATGCGTCTCTCCCCCGGCAAAGAAAACTGCCACGTCATAGACCTAGTCTCCAGCCTTCAGACCGGCATC
GTCACCACCCCAACCCTCTTCGGCCTCGATCCCAGCGAACTAGTCGAAAAGGCATCCGTCGACGACCTCCGCCAC
ATCAAAACCCTCATCGAAGAAGCCAAAGACCGCGACGCAGCCCGCATCCGAGAAGCAACCCTCTTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail