Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2154
Gene name
LocationContig_200:17738..19052
Strand-
Gene length (bp)1314
Transcript length (bp)1314
Coding sequence length (bp)1314
Protein length (aa) 438

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03907 Spo7 Spo7-like protein 8.6E-92 35 267

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9USQ0|SPO7_SCHPO Sporulation-specific protein spo7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=spo7 PE=3 SV=1 31 159 8.0E-18
sp|P18410|SPO7_YEAST Sporulation-specific protein SPO7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPO7 PE=1 SV=1 3 266 1.0E-16

GO

GO Term Description Terminal node
GO:0019888 protein phosphatase regulator activity Yes
GO:0098772 molecular function regulator activity No
GO:0030234 enzyme regulator activity No
GO:0019208 phosphatase regulator activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 54 0.45

Transmembrane Domains

Domain # Start End Length
1 67 84 17
2 104 126 22
3 158 180 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2154
MADDLDSIVKGAPALGPGALLSSTPPGDPLSHAPSAPSMVYLNLLILEASLRAQFLELRARRRHHTFFVALLTVW
VFFFAYRLYLAPREDGRGVGGSIYWAVEGAQRVCFMGGIITAVLVWATGIWDRGIRWPRRWFAISNRGLRIFNCK
LVVVRRPWWAEVLSTVGFFLTYGFFSHTASSSYRLVDPALLREADKELQLSSDSHPTLILPPDDDAAAAEIGHEE
DLAPGGDYVKLLLLAKPFSPTFRENWELYRTEYWERENERRALLRAKVKANDRRVAKQRHGWLWWLPWRQMQPPP
RRHDAHNGQHSSHSKSPLSRGHHRSQSHSEKGRKRRSSSNSIRRLSVGSSRSQTPTLEVDEGLAPRRPGSAGGGS
VSDKRRNKKLTPATRPRRESRSATPDTPSPLTRAATAADDDTPAEGRATRAKAKERQLAVGK*
Coding >Ophun1|2154
ATGGCCGATGACCTCGACTCCATCGTCAAGGGCGCGCCGGCTCTCGGCCCTGGCGCCCTTCTGTCGTCGACGCCG
CCCGGTGACCCTCTCAGCCACGCGCCCAGCGCACCGTCCATGGTCTACCTGAACCTGCTTATCCTCGAAGCATCG
CTGCGGGCTCAGTTTCTAGAGCTACGAGCTCGTCGCCGCCATCATACCTTCTTCGTCGCCCTGCTGACCGTCTGG
GTCTTCTTCTTCGCCTACCGGCTATATCTGGCTCCGCGCGAGGATGGTCGTGGCGTCGGCGGCTCCATCTACTGG
GCCGTTGAGGGAGCTCAGCGCGTGTGCTTCATGGGCGGCATCATCACCGCCGTCCTCGTCTGGGCCACGGGTATA
TGGGACCGCGGCATCCGCTGGCCGCGCCGCTGGTTTGCCATCTCCAACCGTGGCCTGCGCATCTTCAACTGCAAG
CTCGTCGTCGTTCGAAGGCCCTGGTGGGCAGAGGTTCTTTCCACCGTCGGCTTCTTTCTCACCTACGGCTTCTTC
TCCCACACGGCCAGCTCGTCGTATCGCCTAGTCGACCCTGCCCTGCTGCGCGAGGCCGACAAGGAACTTCAGCTC
TCGTCCGACAGCCACCCGACGCTCATCCTACCTCCCGATGACGACGCAGCCGCCGCCGAAATCGGTCACGAGGAG
GATCTAGCCCCTGGAGGCGACTACGTCAAGCTCCTCCTCCTCGCCAAGCCCTTCTCCCCGACATTCCGCGAGAAC
TGGGAGCTCTACCGCACCGAATACTGGGAGAGGGAGAATGAACGTCGCGCCCTTCTGCGGGCCAAGGTCAAAGCC
AACGACCGCCGCGTAGCCAAACAACGACACGGCTGGCTCTGGTGGCTGCCCTGGCGCCAGATGCAGCCACCGCCA
CGGCGACATGATGCCCACAACGGCCAACACAGCAGTCATAGCAAGTCACCCCTCAGCCGTGGCCATCATCGGTCC
CAGTCGCACAGCGAAAAGGGCCGCAAGCGCCGCAGCAGCAGCAACAGCATCCGTCGGCTATCGGTCGGCTCGTCC
CGCAGTCAGACGCCGACGCTCGAAGTCGACGAAGGCCTGGCCCCGCGCCGTCCCGGTTCGGCCGGAGGGGGCTCC
GTGTCGGACAAGCGGCGCAACAAGAAGCTGACGCCGGCGACGAGGCCGAGGCGCGAATCCCGGTCCGCCACGCCC
GATACGCCCTCTCCGCTGACGAGGGCTGCCACCGCCGCGGACGATGATACGCCGGCTGAGGGGCGGGCGACGCGG
GCCAAGGCCAAGGAGAGGCAGTTGGCTGTTGGCAAGTAA
Transcript >Ophun1|2154
ATGGCCGATGACCTCGACTCCATCGTCAAGGGCGCGCCGGCTCTCGGCCCTGGCGCCCTTCTGTCGTCGACGCCG
CCCGGTGACCCTCTCAGCCACGCGCCCAGCGCACCGTCCATGGTCTACCTGAACCTGCTTATCCTCGAAGCATCG
CTGCGGGCTCAGTTTCTAGAGCTACGAGCTCGTCGCCGCCATCATACCTTCTTCGTCGCCCTGCTGACCGTCTGG
GTCTTCTTCTTCGCCTACCGGCTATATCTGGCTCCGCGCGAGGATGGTCGTGGCGTCGGCGGCTCCATCTACTGG
GCCGTTGAGGGAGCTCAGCGCGTGTGCTTCATGGGCGGCATCATCACCGCCGTCCTCGTCTGGGCCACGGGTATA
TGGGACCGCGGCATCCGCTGGCCGCGCCGCTGGTTTGCCATCTCCAACCGTGGCCTGCGCATCTTCAACTGCAAG
CTCGTCGTCGTTCGAAGGCCCTGGTGGGCAGAGGTTCTTTCCACCGTCGGCTTCTTTCTCACCTACGGCTTCTTC
TCCCACACGGCCAGCTCGTCGTATCGCCTAGTCGACCCTGCCCTGCTGCGCGAGGCCGACAAGGAACTTCAGCTC
TCGTCCGACAGCCACCCGACGCTCATCCTACCTCCCGATGACGACGCAGCCGCCGCCGAAATCGGTCACGAGGAG
GATCTAGCCCCTGGAGGCGACTACGTCAAGCTCCTCCTCCTCGCCAAGCCCTTCTCCCCGACATTCCGCGAGAAC
TGGGAGCTCTACCGCACCGAATACTGGGAGAGGGAGAATGAACGTCGCGCCCTTCTGCGGGCCAAGGTCAAAGCC
AACGACCGCCGCGTAGCCAAACAACGACACGGCTGGCTCTGGTGGCTGCCCTGGCGCCAGATGCAGCCACCGCCA
CGGCGACATGATGCCCACAACGGCCAACACAGCAGTCATAGCAAGTCACCCCTCAGCCGTGGCCATCATCGGTCC
CAGTCGCACAGCGAAAAGGGCCGCAAGCGCCGCAGCAGCAGCAACAGCATCCGTCGGCTATCGGTCGGCTCGTCC
CGCAGTCAGACGCCGACGCTCGAAGTCGACGAAGGCCTGGCCCCGCGCCGTCCCGGTTCGGCCGGAGGGGGCTCC
GTGTCGGACAAGCGGCGCAACAAGAAGCTGACGCCGGCGACGAGGCCGAGGCGCGAATCCCGGTCCGCCACGCCC
GATACGCCCTCTCCGCTGACGAGGGCTGCCACCGCCGCGGACGATGATACGCCGGCTGAGGGGCGGGCGACGCGG
GCCAAGGCCAAGGAGAGGCAGTTGGCTGTTGGCAAGTAA
Gene >Ophun1|2154
ATGGCCGATGACCTCGACTCCATCGTCAAGGGCGCGCCGGCTCTCGGCCCTGGCGCCCTTCTGTCGTCGACGCCG
CCCGGTGACCCTCTCAGCCACGCGCCCAGCGCACCGTCCATGGTCTACCTGAACCTGCTTATCCTCGAAGCATCG
CTGCGGGCTCAGTTTCTAGAGCTACGAGCTCGTCGCCGCCATCATACCTTCTTCGTCGCCCTGCTGACCGTCTGG
GTCTTCTTCTTCGCCTACCGGCTATATCTGGCTCCGCGCGAGGATGGTCGTGGCGTCGGCGGCTCCATCTACTGG
GCCGTTGAGGGAGCTCAGCGCGTGTGCTTCATGGGCGGCATCATCACCGCCGTCCTCGTCTGGGCCACGGGTATA
TGGGACCGCGGCATCCGCTGGCCGCGCCGCTGGTTTGCCATCTCCAACCGTGGCCTGCGCATCTTCAACTGCAAG
CTCGTCGTCGTTCGAAGGCCCTGGTGGGCAGAGGTTCTTTCCACCGTCGGCTTCTTTCTCACCTACGGCTTCTTC
TCCCACACGGCCAGCTCGTCGTATCGCCTAGTCGACCCTGCCCTGCTGCGCGAGGCCGACAAGGAACTTCAGCTC
TCGTCCGACAGCCACCCGACGCTCATCCTACCTCCCGATGACGACGCAGCCGCCGCCGAAATCGGTCACGAGGAG
GATCTAGCCCCTGGAGGCGACTACGTCAAGCTCCTCCTCCTCGCCAAGCCCTTCTCCCCGACATTCCGCGAGAAC
TGGGAGCTCTACCGCACCGAATACTGGGAGAGGGAGAATGAACGTCGCGCCCTTCTGCGGGCCAAGGTCAAAGCC
AACGACCGCCGCGTAGCCAAACAACGACACGGCTGGCTCTGGTGGCTGCCCTGGCGCCAGATGCAGCCACCGCCA
CGGCGACATGATGCCCACAACGGCCAACACAGCAGTCATAGCAAGTCACCCCTCAGCCGTGGCCATCATCGGTCC
CAGTCGCACAGCGAAAAGGGCCGCAAGCGCCGCAGCAGCAGCAACAGCATCCGTCGGCTATCGGTCGGCTCGTCC
CGCAGTCAGACGCCGACGCTCGAAGTCGACGAAGGCCTGGCCCCGCGCCGTCCCGGTTCGGCCGGAGGGGGCTCC
GTGTCGGACAAGCGGCGCAACAAGAAGCTGACGCCGGCGACGAGGCCGAGGCGCGAATCCCGGTCCGCCACGCCC
GATACGCCCTCTCCGCTGACGAGGGCTGCCACCGCCGCGGACGATGATACGCCGGCTGAGGGGCGGGCGACGCGG
GCCAAGGCCAAGGAGAGGCAGTTGGCTGTTGGCAAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail