Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|215
Gene name
LocationContig_1041:771..4546
Strand+
Gene length (bp)3775
Transcript length (bp)2829
Coding sequence length (bp)2829
Protein length (aa) 943

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04515 Choline_transpo Plasma-membrane choline transporter 1.7E-31 397 721

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O74441|CTL1_SCHPO Choline transporter-like protein ctl1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ctl1 PE=1 SV=1 288 739 1.0E-38

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0051179 localization No
GO:0005215 transporter activity No
GO:0051234 establishment of localization No
GO:0003674 molecular_function No
GO:0009987 cellular process No
GO:0006810 transport No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 43 0.45

Transmembrane Domains

Domain # Start End Length
1 281 303 22
2 323 345 22
3 352 374 22
4 389 408 19
5 435 457 22
6 477 499 22
7 644 666 22
8 681 703 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|215
MFSEYASRFLAQSQSRLSNLGQPEGDHPTRPTGDWPSSRPGRRERASQPARTILSRGNPYQQNGAGSRFGHLGFA
SRISAAQDAPLFHSTLDEFREEDDEEEEREREAADLFALQRSRRVAAASKLAESAESAVSHGSDGATATDHRPYE
YPGIKSSWKGTRSRHENRRPSHGALMEDGEDDEDDGGKGKMVDIGLESQEDGDGGDPPESLLGGEVSGDDHDQQP
STPPFRSLQPAVSEREPFISKRSSMDSEEPGSVRPRESEASNATPTVEGELFRHDPFFAWIFLISLGGMMSTFIL
VWLHTSPRKSPVGDTIYTTLQKSFDMLAIDTVVSIMVSLVWLAALRSFVRPLVSVILVAVPVIMFSFSIYSFVSS
FQGRTGGASAQDTVMRWASLVPAGACLLWLWLVVKGRRAIQQAIEMLQFSSKILAQNPGLLAVGFGSLALIVLWT
WAWLAMFTRVFMGGYFSQSLVRFVIRLSSWWLGAAFILMYLWTLAVINGIHRATTAATVSQWYFHRNAGPTTASR
DIVTAALSHATTTMFGSICQSTLLALLLRAPLLFLPRRAGTALANLAAFWVPTPMMALTNPLTVTYSAIHSQGLV
TSARGLDRMDVVSPTLATTTLTPRALRARGGTASGLLPYRLAKLLLVATRFAMATGLGFAGWIMTAKQLQVQLPD
GMGVRGSAYAYVVGIMASFIGYSVMGAMEGILSGIVDAVLICYGSERRMERGQGRFCLEAAYLFGEGRAGEGGFY
VNIYTKKSQWEKPTAPVFPMSDNAAAEEPPPGYEPGNGPAPTDVKKNPYEQQHAANTAGPSEDEDARLAAKLQAE
EDARARYASPGGGGGAQYGGQQQGQFPQDLPPRDRAASKGGFLGKLFGKGKAPAGVGGYGSQPQQQQGYYQSTPP
PQQYGGYPGGYGGPPAQQQGYGQGGYGGYGGYPPQQGGCSCR*
Coding >Ophun1|215
ATGTTTTCGGAGTATGCCTCACGCTTTCTAGCACAGTCACAGTCCCGGCTGTCCAACTTGGGTCAGCCCGAAGGC
GATCACCCCACGCGACCGACCGGCGACTGGCCTTCGTCGAGGCCCGGTCGTAGAGAGCGAGCGAGCCAGCCGGCG
AGGACGATTCTTTCGCGCGGGAATCCCTACCAGCAGAACGGCGCTGGATCGCGCTTCGGTCACTTGGGGTTTGCG
TCGCGCATCTCTGCCGCTCAGGACGCACCGCTCTTTCACAGTACCTTGGATGAGTTCCGCGAGGAGGATGACGAG
GAGGAGGAGCGGGAGCGGGAGGCTGCTGATCTGTTCGCGCTGCAGCGTTCTAGGCGCGTCGCTGCTGCTAGCAAG
CTCGCCGAGAGTGCCGAGTCGGCTGTCAGCCACGGCTCTGATGGCGCCACCGCCACAGATCATCGCCCTTACGAA
TATCCCGGCATCAAGAGCAGCTGGAAGGGGACGCGCAGCAGACATGAGAACCGCCGCCCGTCGCACGGTGCGCTG
ATGGAGGACGGCGAGGACGACGAGGACGATGGTGGAAAGGGGAAGATGGTCGATATCGGGCTGGAGTCGCAGGAG
GATGGCGATGGGGGGGATCCTCCCGAGTCTCTGTTGGGCGGAGAGGTGTCTGGTGACGATCATGACCAGCAGCCG
AGCACGCCGCCTTTTCGGTCTCTTCAGCCGGCCGTGTCCGAGCGGGAGCCTTTCATCTCTAAGAGGAGCTCGATG
GACTCGGAGGAGCCCGGCAGTGTTCGGCCCCGTGAGAGCGAGGCGAGCAATGCAACACCTACGGTTGAGGGCGAG
CTATTCCGGCACGATCCTTTCTTTGCCTGGATATTCCTCATCAGTCTCGGCGGGATGATGTCGACGTTTATCCTC
GTCTGGCTGCATACGTCTCCGCGCAAGAGCCCGGTCGGCGACACCATCTACACGACGCTGCAAAAGTCGTTTGAC
ATGCTGGCCATTGACACGGTCGTCTCCATCATGGTGTCGCTGGTATGGCTGGCGGCTCTGCGGTCGTTTGTGAGG
CCGCTCGTCAGCGTCATCCTGGTGGCGGTGCCCGTCATCATGTTCTCCTTTTCCATCTACTCCTTCGTCTCGTCA
TTCCAGGGCCGGACGGGGGGGGCCAGCGCTCAGGACACTGTGATGCGATGGGCGTCGCTGGTTCCAGCTGGTGCT
TGCCTCCTCTGGCTTTGGCTCGTGGTCAAGGGCCGTCGAGCCATCCAGCAGGCCATCGAGATGCTGCAGTTTTCG
TCCAAGATTCTGGCGCAGAACCCCGGGTTGCTGGCCGTTGGCTTCGGAAGCCTGGCGCTCATTGTGCTGTGGACC
TGGGCGTGGCTGGCCATGTTCACGCGTGTGTTTATGGGCGGCTACTTCTCGCAGTCGCTGGTTCGGTTCGTGATC
CGGCTGTCGAGCTGGTGGTTGGGCGCGGCCTTTATCCTCATGTACCTGTGGACGCTGGCCGTCATCAACGGCATT
CACCGGGCGACGACGGCGGCGACGGTATCGCAGTGGTACTTTCATCGAAACGCTGGGCCGACGACGGCATCGCGC
GACATCGTGACGGCGGCCCTGAGCCACGCGACGACGACCATGTTTGGCAGCATCTGCCAGTCGACGCTGCTGGCT
CTGCTGCTGCGGGCGCCTCTGCTCTTCCTACCGCGACGGGCCGGCACGGCTCTGGCCAACCTGGCGGCCTTTTGG
GTCCCGACGCCCATGATGGCACTGACGAACCCGCTGACGGTGACGTACTCGGCCATCCACTCTCAGGGCCTGGTG
ACGTCGGCGCGCGGACTGGACCGGATGGACGTTGTATCGCCGACGCTGGCGACGACGACGCTGACGCCCCGGGCG
TTGAGGGCTCGTGGCGGTACGGCCAGCGGATTGCTCCCCTACCGACTGGCCAAGTTACTGCTGGTGGCGACGCGC
TTCGCCATGGCCACGGGTCTGGGCTTCGCCGGCTGGATAATGACGGCCAAGCAGCTTCAGGTCCAGCTCCCGGAC
GGCATGGGCGTGCGAGGGTCGGCCTACGCGTACGTGGTGGGCATCATGGCCAGCTTCATCGGCTACTCGGTCATG
GGCGCCATGGAGGGAATCCTCAGCGGCATCGTCGACGCCGTGCTCATCTGCTACGGGAGCGAGCGGCGAATGGAG
AGGGGTCAGGGACGCTTCTGCCTGGAGGCTGCTTATCTGTTTGGGGAGGGGAGGGCTGGGGAGGGGGGGTTCTAC
GTCAACATCTACACCAAAAAGTCGCAGTGGGAGAAGCCAACAGCGCCCGTATTCCCCATGAGCGACAACGCAGCG
GCCGAAGAGCCACCGCCGGGGTACGAGCCGGGAAACGGTCCCGCCCCCACAGACGTCAAGAAGAATCCCTACGAG
CAGCAGCACGCCGCCAACACCGCCGGCCCTTCTGAAGATGAGGACGCTAGGCTCGCTGCCAAGCTGCAGGCCGAG
GAGGACGCGAGAGCTCGCTATGCCAGTCCCGGGGGGGGTGGCGGCGCGCAGTATGGCGGTCAGCAGCAGGGACAG
TTCCCGCAGGATTTACCGCCTCGTGATCGAGCGGCTTCCAAGGGGGGGTTTCTGGGGAAGCTGTTTGGCAAGGGG
AAGGCTCCGGCTGGTGTGGGGGGGTATGGCTCGCAGCCTCAGCAGCAGCAGGGATACTACCAGTCAACGCCGCCG
CCGCAGCAGTACGGTGGATATCCGGGGGGCTATGGAGGGCCGCCGGCGCAGCAGCAGGGGTACGGACAGGGCGGA
TATGGCGGCTACGGGGGATATCCGCCTCAGCAGGGTGGATGCTCATGCCGATGA
Transcript >Ophun1|215
ATGTTTTCGGAGTATGCCTCACGCTTTCTAGCACAGTCACAGTCCCGGCTGTCCAACTTGGGTCAGCCCGAAGGC
GATCACCCCACGCGACCGACCGGCGACTGGCCTTCGTCGAGGCCCGGTCGTAGAGAGCGAGCGAGCCAGCCGGCG
AGGACGATTCTTTCGCGCGGGAATCCCTACCAGCAGAACGGCGCTGGATCGCGCTTCGGTCACTTGGGGTTTGCG
TCGCGCATCTCTGCCGCTCAGGACGCACCGCTCTTTCACAGTACCTTGGATGAGTTCCGCGAGGAGGATGACGAG
GAGGAGGAGCGGGAGCGGGAGGCTGCTGATCTGTTCGCGCTGCAGCGTTCTAGGCGCGTCGCTGCTGCTAGCAAG
CTCGCCGAGAGTGCCGAGTCGGCTGTCAGCCACGGCTCTGATGGCGCCACCGCCACAGATCATCGCCCTTACGAA
TATCCCGGCATCAAGAGCAGCTGGAAGGGGACGCGCAGCAGACATGAGAACCGCCGCCCGTCGCACGGTGCGCTG
ATGGAGGACGGCGAGGACGACGAGGACGATGGTGGAAAGGGGAAGATGGTCGATATCGGGCTGGAGTCGCAGGAG
GATGGCGATGGGGGGGATCCTCCCGAGTCTCTGTTGGGCGGAGAGGTGTCTGGTGACGATCATGACCAGCAGCCG
AGCACGCCGCCTTTTCGGTCTCTTCAGCCGGCCGTGTCCGAGCGGGAGCCTTTCATCTCTAAGAGGAGCTCGATG
GACTCGGAGGAGCCCGGCAGTGTTCGGCCCCGTGAGAGCGAGGCGAGCAATGCAACACCTACGGTTGAGGGCGAG
CTATTCCGGCACGATCCTTTCTTTGCCTGGATATTCCTCATCAGTCTCGGCGGGATGATGTCGACGTTTATCCTC
GTCTGGCTGCATACGTCTCCGCGCAAGAGCCCGGTCGGCGACACCATCTACACGACGCTGCAAAAGTCGTTTGAC
ATGCTGGCCATTGACACGGTCGTCTCCATCATGGTGTCGCTGGTATGGCTGGCGGCTCTGCGGTCGTTTGTGAGG
CCGCTCGTCAGCGTCATCCTGGTGGCGGTGCCCGTCATCATGTTCTCCTTTTCCATCTACTCCTTCGTCTCGTCA
TTCCAGGGCCGGACGGGGGGGGCCAGCGCTCAGGACACTGTGATGCGATGGGCGTCGCTGGTTCCAGCTGGTGCT
TGCCTCCTCTGGCTTTGGCTCGTGGTCAAGGGCCGTCGAGCCATCCAGCAGGCCATCGAGATGCTGCAGTTTTCG
TCCAAGATTCTGGCGCAGAACCCCGGGTTGCTGGCCGTTGGCTTCGGAAGCCTGGCGCTCATTGTGCTGTGGACC
TGGGCGTGGCTGGCCATGTTCACGCGTGTGTTTATGGGCGGCTACTTCTCGCAGTCGCTGGTTCGGTTCGTGATC
CGGCTGTCGAGCTGGTGGTTGGGCGCGGCCTTTATCCTCATGTACCTGTGGACGCTGGCCGTCATCAACGGCATT
CACCGGGCGACGACGGCGGCGACGGTATCGCAGTGGTACTTTCATCGAAACGCTGGGCCGACGACGGCATCGCGC
GACATCGTGACGGCGGCCCTGAGCCACGCGACGACGACCATGTTTGGCAGCATCTGCCAGTCGACGCTGCTGGCT
CTGCTGCTGCGGGCGCCTCTGCTCTTCCTACCGCGACGGGCCGGCACGGCTCTGGCCAACCTGGCGGCCTTTTGG
GTCCCGACGCCCATGATGGCACTGACGAACCCGCTGACGGTGACGTACTCGGCCATCCACTCTCAGGGCCTGGTG
ACGTCGGCGCGCGGACTGGACCGGATGGACGTTGTATCGCCGACGCTGGCGACGACGACGCTGACGCCCCGGGCG
TTGAGGGCTCGTGGCGGTACGGCCAGCGGATTGCTCCCCTACCGACTGGCCAAGTTACTGCTGGTGGCGACGCGC
TTCGCCATGGCCACGGGTCTGGGCTTCGCCGGCTGGATAATGACGGCCAAGCAGCTTCAGGTCCAGCTCCCGGAC
GGCATGGGCGTGCGAGGGTCGGCCTACGCGTACGTGGTGGGCATCATGGCCAGCTTCATCGGCTACTCGGTCATG
GGCGCCATGGAGGGAATCCTCAGCGGCATCGTCGACGCCGTGCTCATCTGCTACGGGAGCGAGCGGCGAATGGAG
AGGGGTCAGGGACGCTTCTGCCTGGAGGCTGCTTATCTGTTTGGGGAGGGGAGGGCTGGGGAGGGGGGGTTCTAC
GTCAACATCTACACCAAAAAGTCGCAGTGGGAGAAGCCAACAGCGCCCGTATTCCCCATGAGCGACAACGCAGCG
GCCGAAGAGCCACCGCCGGGGTACGAGCCGGGAAACGGTCCCGCCCCCACAGACGTCAAGAAGAATCCCTACGAG
CAGCAGCACGCCGCCAACACCGCCGGCCCTTCTGAAGATGAGGACGCTAGGCTCGCTGCCAAGCTGCAGGCCGAG
GAGGACGCGAGAGCTCGCTATGCCAGTCCCGGGGGGGGTGGCGGCGCGCAGTATGGCGGTCAGCAGCAGGGACAG
TTCCCGCAGGATTTACCGCCTCGTGATCGAGCGGCTTCCAAGGGGGGGTTTCTGGGGAAGCTGTTTGGCAAGGGG
AAGGCTCCGGCTGGTGTGGGGGGGTATGGCTCGCAGCCTCAGCAGCAGCAGGGATACTACCAGTCAACGCCGCCG
CCGCAGCAGTACGGTGGATATCCGGGGGGCTATGGAGGGCCGCCGGCGCAGCAGCAGGGGTACGGACAGGGCGGA
TATGGCGGCTACGGGGGATATCCGCCTCAGCAGGGTGGATGCTCATGCCGATGA
Gene >Ophun1|215
ATGTTTTCGGAGTGTGCGTCAGGCCCAGCCTTGCACGTCGTTTCCCTTGCTGTACTGACGCCCGTCGATTAGATG
CCTCACGCTTTCTAGCACAGTCACAGTCCCGGCTGTCCAACTTGGGTCAGCCCGAAGGCGATCACCCCACGCGAC
CGACCGGCGACTGGCCTTCGTCGAGGCCCGGTCGTAGAGAGCGAGCGAGCCAGCCGGCGAGGACGATTCTTTCGC
GCGGGAATCCCTACCAGCAGAACGGCGCTGGATCGCGCTTCGGTCACTTGGGGTTTGCGTCGCGCATCTCTGCCG
CTCAGGACGCACCGCTCTTTCACAGTACCTTGGATGAGTTCCGCGAGGAGGATGACGAGGAGGAGGAGCGGGAGC
GGGAGGCTGCTGATCTGTTCGCGCTGCAGCGTTCTAGGCGCGTCGCTGCTGCTAGCAAGCTCGCCGAGAGTGCCG
AGTCGGCTGTCAGCCACGGCTCTGATGGCGCCACCGCCACAGATCATCGCCCTTACGAATATCCCGGCATCAAGA
GCAGCTGGAAGGGGACGCGCAGCAGACATGAGAACCGCCGCCCGTCGCACGGTGCGCTGATGGAGGACGGCGAGG
ACGACGAGGACGATGGTGGAAAGGGGAAGATGGTCGATATCGGGCTGGAGTCGCAGGAGGATGGCGATGGGGGGG
ATCCTCCCGAGTCTCTGTTGGGCGGAGAGGTGTCTGGTGACGATCATGACCAGCAGCCGAGCACGCCGCCTTTTC
GGTCTCTTCAGCCGGCCGTGTCCGAGCGGGAGCCTTTCATCTCTAAGAGGAGCTCGATGGACTCGGAGGAGCCCG
GCAGTGTTCGGCCCCGTGAGAGCGAGGCGAGCAATGCAACACCTACGGTTGAGGGCGAGCTATTCCGGCACGATC
CTTTCTTTGCCTGGATATTCCTCATCAGTCTCGGCGGGATGATGTCGACGTTTATCCTCGTCTGGCTGCATACGT
CTCCGCGCAAGAGCCCGGTCGGCGACACCATCTACACGACGCTGCAAAAGTCGTTTGACATGCTGGCCATTGACA
CGGTCGTCTCCATCATGGTGTCGCTGGTATGGCTGGCGGCTCTGCGGTCGTTTGTGAGGCCGCTCGTCAGCGTCA
TCCTGGTGGCGGTGCCCGTCATCATGTTCTCCTTTTCCATCTACTCCTTCGTCTCGTCATTCCAGGGCCGGACGG
GGGGGGCCAGCGCTCAGGACACTGTGATGCGATGGGCGTCGCTGGTTCCAGCTGGTGCTTGCCTCCTCTGGCTTT
GGCTCGTGGTCAAGGGCCGTCGAGCCATCCAGCAGGCCATCGAGATGCTGCAGTTTTCGTCCAAGATTCTGGCGC
AGAACCCCGGGTTGCTGGCCGTTGGCTTCGGAAGCCTGGCGCTCATTGTGCTGTGGACCTGGGCGTGGCTGGCCA
TGTTCACGCGTGTGTTTATGGGCGGCTACTTCTCGCAGTCGCTGGTTCGGTTCGTGATCCGGCTGTCGAGCTGGT
GGTTGGGCGCGGCCTTTATCCTCATGTACCTGTGGACGCTGGCCGTCATCAACGGCATTCACCGGGCGACGACGG
CGGCGACGGTATCGCAGTGGTACTTTCATCGAAACGCTGGGCCGACGACGGCATCGCGCGACATCGTGACGGCGG
CCCTGAGCCACGCGACGACGACCATGTTTGGCAGCATCTGCCAGTCGACGCTGCTGGCTCTGCTGCTGCGGGCGC
CTCTGCTCTTCCTACCGCGACGGGCCGGCACGGCTCTGGCCAACCTGGCGGCCTTTTGGGTCCCGACGCCCATGA
TGGCACTGACGAACCCGCTGACGGTGACGTACTCGGCCATCCACTCTCAGGGCCTGGTGACGTCGGCGCGCGGAC
TGGACCGGATGGACGTTGTATCGCCGACGCTGGCGACGACGACGCTGACGCCCCGGGCGTTGAGGGCTCGTGGCG
GTACGGCCAGCGGATTGCTCCCCTACCGACTGGCCAAGTTACTGCTGGTGGCGACGCGCTTCGCCATGGCCACGG
GTCTGGGCTTCGCCGGCTGGATAATGACGGCCAAGCAGCTTCAGGTCCAGCTCCCGGACGGCATGGGCGTGCGAG
GGTCGGCCTACGCGTACGTGGTGGGCATCATGGCCAGCTTCATCGGCTACTCGGTCATGGGCGCCATGGAGGGAA
TCCTCAGCGGCATCGTCGACGCCGTGCTCATCTGCTACGGGAGCGAGCGGCGAATGGAGAGGGGTCAGGGACGCT
TCTGCCTGGAGGCTGCTTATCTGTTTGGGGAGGGGAGGGCTGGGGAGGGGGGGTATGTTTAGGGATAGGTGGCGA
TGGGGATGGGGGAGGATGCTGCTTTAGCGAGTGTTATTAGGGAGAGTGAAGGTTGATTTGCAGCGTTGCGGGCGG
CTGAGGCTGTCTTGAGCTTGTGCGGTAGACGATAATAAACACGTCTATCTATTATCTATATTTATACTCTTTCAC
AGCCAACCTTGGTTGATGAATGATAACAAACAAACAAAGAGTTGGTTGATGTTTCGCCGACTCAGATGACTACCA
GATGACCAGGGATCAATAACGGTCCGTCCCCCGCCCCGGACTCCGCCACATGCGCCCCACCGATTGCGTAAGTGA
CGATGACGGACGGCTCTTGGATGCTGACGACAAGGCAATTCCGCGCCCTCTTCTCCCTTGTGCATCTTCTACTCC
TACGACCTACGAATAGCGGTGATTGATACAGTCGTTCTTGAAGAGACGCGACGCAGATTCTTCGAGTGTCGTCGG
CTATCGAGTCGTTACCTTACCTATGGCTGATTATCTTCCTCCCTGTGGCCCGCCGCCGCCCAGGGCGCCCGAGGT
GCCGGCTGGATGGGCAGCGCGCTGGAACGAGCAGTATAAAGAATGGTGCGTTGCTCATCATCATCATCATCATCA
TCATCATCGTCATAATCATCACTAGGGAACACACACCTAACCCCCCGCAACAGGTTCTACGTCAACATCTACACC
AAAAAGTCGCAGTGGGAGAAGCCAACAGCGCCCGTATTCCCCATGAGCGACAACGCAGCGGCCGAAGAGCCACCG
CCGGGGTACGAGCCGGGAAACGGTCCCGCCCCCACAGACGTCAAGAAGAATCCCTACGAGCAGCAGCACGCCGCC
AACACCGCCGGCCCTTCTGAAGATGAGGACGCTAGGCTCGCTGCCAAGCTGCAGGCCGAGGAGGACGCGAGAGCT
CGCTATGCCAGTCCCGGGGGGGGTGGCGGCGCGCAGTATGGCGGTCAGCAGCAGGGACAGTTCCCGCAGGATTTA
CCGCCTCGTGATCGAGCGGCTTCCAAGGGGGGGTTTCTGGGGAAGCTGTTTGGCAAGGGGAAGGCTCCGGCTGGT
GTGGGGGGGTATGGCTCGCAGCCTCAGCAGCAGCAGGGATACTACCAGTCAACGCCGCCGCCGCAGCAGTACGGT
GGATATCCGGGGGGCTATGGAGGGCCGCCGGCGCAGCAGCAGGGGTACGGACAGGGCGGATATGGCGGCTACGGG
GGATATCCGCCTCAGCAGGGGTACGGGCCGCCGCAGACGCAGGCGGGAGGGAGGAAACCTGGGGGGGGGGGGGGG
ATGGGCATGGGGCTTGCTGGAGGGGCTGCGATGGGGTTGTTGGGCGGTGGTCTGCTCGCTAATCACGAGAGGCAC
GAGCGGGATGAGGCGTATGACGAGGGATACAGTGAGTTGTTCCTGGGGGTTGTCTGTGAAGTGTTGCTGACTTTG
TGGCAGTGGATGCTCATGCCGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail