Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|213
Gene name
LocationContig_1040:2288..3299
Strand-
Gene length (bp)1011
Transcript length (bp)933
Coding sequence length (bp)933
Protein length (aa) 311

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01778 Ribosomal_L28e Ribosomal L28e protein family 1.1E-39 6 120
PF04874 Mak16 Mak16 protein C-terminal region 8.5E-28 144 238

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UTE6|MAK16_SCHPO Protein mak16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mak16 PE=3 SV=1 1 291 4.0E-87
sp|P10962|MAK16_YEAST Protein MAK16 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MAK16 PE=1 SV=2 3 246 5.0E-87
sp|Q6P7N1|MAK16_XENTR Protein MAK16 homolog OS=Xenopus tropicalis GN=mak16 PE=2 SV=1 1 222 2.0E-65
sp|Q66L33|MK16A_XENLA Protein MAK16 homolog A OS=Xenopus laevis GN=mak16-a PE=2 SV=1 1 183 4.0E-65
sp|Q7ZYG5|MK16B_XENLA Protein MAK16 homolog B OS=Xenopus laevis GN=mak16-b PE=2 SV=1 1 183 1.0E-64
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UTE6|MAK16_SCHPO Protein mak16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mak16 PE=3 SV=1 1 291 4.0E-87
sp|P10962|MAK16_YEAST Protein MAK16 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MAK16 PE=1 SV=2 3 246 5.0E-87
sp|Q6P7N1|MAK16_XENTR Protein MAK16 homolog OS=Xenopus tropicalis GN=mak16 PE=2 SV=1 1 222 2.0E-65
sp|Q66L33|MK16A_XENLA Protein MAK16 homolog A OS=Xenopus laevis GN=mak16-a PE=2 SV=1 1 183 4.0E-65
sp|Q7ZYG5|MK16B_XENLA Protein MAK16 homolog B OS=Xenopus laevis GN=mak16-b PE=2 SV=1 1 183 1.0E-64
sp|Q6NYD4|MAK16_DANRE Protein MAK16 homolog OS=Danio rerio GN=mak16 PE=2 SV=1 1 205 1.0E-63
sp|Q9BXY0|MAK16_HUMAN Protein MAK16 homolog OS=Homo sapiens GN=MAK16 PE=1 SV=2 1 256 1.0E-62
sp|Q1RML7|MAK16_BOVIN Protein MAK16 homolog OS=Bos taurus GN=MAK16 PE=2 SV=1 1 284 9.0E-62
sp|Q8BGS0|MAK16_MOUSE Protein MAK16 homolog OS=Mus musculus GN=Mak16 PE=1 SV=1 1 183 2.0E-60
sp|Q55DJ3|MAK16_DICDI Protein MAK16 homolog OS=Dictyostelium discoideum GN=mak16l PE=3 SV=1 1 206 2.0E-55
sp|P46435|MAK16_SCHMA Protein MAK16 homolog OS=Schistosoma mansoni GN=MAK16 PE=1 SV=2 1 199 5.0E-46
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|213
MASDEIVWQIINQQFCSYKLKTEKKQNFCRNEYNVTGLCNRQSCPLANSRYATVRQHPTKETLYLYTKTIERAHL
PSKTWERIKLSNNYSKALEQIDEALIYWPKFLVHKCKQRLTRLTQVQMRSRRLAAEEERLGERLVPKLAPKVRHR
EAARERKAEAAAKLERTIERELAERLRQGAYGDQPLNVSEAIWKKVLNAMERGGEGVRDEDMDEGVESDDEDKEI
EYVSDGSESEKELDALEEWLGSDEEEDEDEDEVDDEDEDEEEEEEGDKAELKKRKRAMAVKARSRKRVKDNDGRE
KLAVANPLEW*
Coding >Ophun1|213
ATGGCGTCAGACGAGATTGTGTGGCAGATTATCAATCAGCAGTTTTGCTCTTACAAGCTCAAGACGGAGAAGAAG
CAAAACTTTTGCCGCAACGAGTACAACGTCACGGGCCTCTGCAATCGACAGTCATGTCCGCTCGCCAACTCTCGC
TACGCCACCGTGCGCCAGCATCCGACCAAGGAGACGCTCTACCTCTACACCAAGACCATCGAGCGCGCCCACCTG
CCGTCCAAGACGTGGGAGCGCATCAAGCTGTCCAACAACTACTCCAAGGCTCTCGAGCAGATTGACGAGGCCCTC
ATCTACTGGCCCAAGTTTCTGGTGCACAAGTGCAAGCAGCGGCTGACGCGCCTGACGCAGGTGCAGATGCGGTCG
CGGAGATTGGCGGCCGAGGAGGAGAGGTTGGGCGAGAGGCTGGTGCCCAAGCTTGCGCCCAAGGTGCGGCATCGT
GAGGCGGCGCGCGAGAGAAAGGCCGAGGCGGCTGCTAAGCTTGAGCGGACGATTGAGCGCGAGTTGGCCGAGAGG
TTGCGACAGGGGGCGTATGGGGATCAGCCTTTGAATGTGAGCGAGGCTATCTGGAAAAAGGTGCTCAATGCCATG
GAGAGGGGAGGCGAGGGTGTGAGGGATGAGGATATGGATGAGGGTGTTGAGAGCGATGACGAGGATAAGGAGATT
GAGTACGTGTCGGACGGCAGCGAGAGCGAGAAGGAGCTGGATGCTTTGGAGGAGTGGCTCGGAAGCGACGAGGAG
GAGGATGAGGATGAGGATGAAGTCGATGATGAAGACGAGGACGAGGAAGAAGAGGAAGAGGGAGACAAGGCGGAG
CTCAAGAAGCGCAAGCGTGCCATGGCTGTCAAGGCGCGGAGCAGGAAGCGGGTCAAGGACAACGATGGACGGGAG
AAGCTGGCGGTTGCGAATCCGCTGGAGTGGTAG
Transcript >Ophun1|213
ATGGCGTCAGACGAGATTGTGTGGCAGATTATCAATCAGCAGTTTTGCTCTTACAAGCTCAAGACGGAGAAGAAG
CAAAACTTTTGCCGCAACGAGTACAACGTCACGGGCCTCTGCAATCGACAGTCATGTCCGCTCGCCAACTCTCGC
TACGCCACCGTGCGCCAGCATCCGACCAAGGAGACGCTCTACCTCTACACCAAGACCATCGAGCGCGCCCACCTG
CCGTCCAAGACGTGGGAGCGCATCAAGCTGTCCAACAACTACTCCAAGGCTCTCGAGCAGATTGACGAGGCCCTC
ATCTACTGGCCCAAGTTTCTGGTGCACAAGTGCAAGCAGCGGCTGACGCGCCTGACGCAGGTGCAGATGCGGTCG
CGGAGATTGGCGGCCGAGGAGGAGAGGTTGGGCGAGAGGCTGGTGCCCAAGCTTGCGCCCAAGGTGCGGCATCGT
GAGGCGGCGCGCGAGAGAAAGGCCGAGGCGGCTGCTAAGCTTGAGCGGACGATTGAGCGCGAGTTGGCCGAGAGG
TTGCGACAGGGGGCGTATGGGGATCAGCCTTTGAATGTGAGCGAGGCTATCTGGAAAAAGGTGCTCAATGCCATG
GAGAGGGGAGGCGAGGGTGTGAGGGATGAGGATATGGATGAGGGTGTTGAGAGCGATGACGAGGATAAGGAGATT
GAGTACGTGTCGGACGGCAGCGAGAGCGAGAAGGAGCTGGATGCTTTGGAGGAGTGGCTCGGAAGCGACGAGGAG
GAGGATGAGGATGAGGATGAAGTCGATGATGAAGACGAGGACGAGGAAGAAGAGGAAGAGGGAGACAAGGCGGAG
CTCAAGAAGCGCAAGCGTGCCATGGCTGTCAAGGCGCGGAGCAGGAAGCGGGTCAAGGACAACGATGGACGGGAG
AAGCTGGCGGTTGCGAATCCGCTGGAGTGGTAG
Gene >Ophun1|213
ATGGCGTCAGACGAGATTGTGTGGCAGATTATCAATCAGCAGTTTTGCTCTTACAAGCTCAAGTCAGTGGCTCGC
TCTCGTCTGCTCTCTTCACGCATCGGATTCGTCCTCGTTTCGGCCTCGTACTGACAGGACTTCAGGACGGAGAAG
AAGCAAAACTTTTGCCGCAACGAGTACAACGTCACGGGCCTCTGCAATCGACAGTCATGTCCGCTCGCCAACTCT
CGCTACGCCACCGTGCGCCAGCATCCGACCAAGGAGACGCTCTACCTCTACACCAAGACCATCGAGCGCGCCCAC
CTGCCGTCCAAGACGTGGGAGCGCATCAAGCTGTCCAACAACTACTCCAAGGCTCTCGAGCAGATTGACGAGGCC
CTCATCTACTGGCCCAAGTTTCTGGTGCACAAGTGCAAGCAGCGGCTGACGCGCCTGACGCAGGTGCAGATGCGG
TCGCGGAGATTGGCGGCCGAGGAGGAGAGGTTGGGCGAGAGGCTGGTGCCCAAGCTTGCGCCCAAGGTGCGGCAT
CGTGAGGCGGCGCGCGAGAGAAAGGCCGAGGCGGCTGCTAAGCTTGAGCGGACGATTGAGCGCGAGTTGGCCGAG
AGGTTGCGACAGGGGGCGTATGGGGATCAGCCTTTGAATGTGAGCGAGGCTATCTGGAAAAAGGTGCTCAATGCC
ATGGAGAGGGGAGGCGAGGGTGTGAGGGATGAGGATATGGATGAGGGTGTTGAGAGCGATGACGAGGATAAGGAG
ATTGAGTACGTGTCGGACGGCAGCGAGAGCGAGAAGGAGCTGGATGCTTTGGAGGAGTGGCTCGGAAGCGACGAG
GAGGAGGATGAGGATGAGGATGAAGTCGATGATGAAGACGAGGACGAGGAAGAAGAGGAAGAGGGAGACAAGGCG
GAGCTCAAGAAGCGCAAGCGTGCCATGGCTGTCAAGGCGCGGAGCAGGAAGCGGGTCAAGGACAACGATGGACGG
GAGAAGCTGGCGGTTGCGAATCCGCTGGAGTGGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail