Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2121
Gene name
LocationContig_2:102660..103741
Strand-
Gene length (bp)1081
Transcript length (bp)1017
Coding sequence length (bp)1017
Protein length (aa) 339

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04695 Pex14_N Pex14 N-terminal domain 1.7E-17 27 70

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3166
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3353
Ophiocordyceps australis map64 (Brazil) OphauB2|2525
Ophiocordyceps camponoti-floridani Ophcf2|04304
Ophiocordyceps camponoti-rufipedis Ophun1|2121 (this protein)
Ophiocordyceps kimflemingae Ophio5|1399
Ophiocordyceps subramaniannii Hirsu2|5642

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2121
MDDSEDSESHSQSDHNQPSQSAATQPQDQLHTARRFLQDDHVKTASLEEKASFLKSKGVSDGDIQKLLAELESSS
RQTETAEPEPQSPTNTPNRPANSHPSEETETDRPPIVTYPEFLAKPARPPPLVTTTRLLNTVYGFAGFATLLYGT
SKYYLAPMVDDLTEARSNLYTTATSKLLALIPTLEKSVSVIPPTASHSAPADDASDAEDPSEMFHRDVGTQTSLP
DSPAGTAQVRPVAGSPSDRQADRLSDAVRTLSGLKDDFRSQCDHLEDLRTLLDVLRDDLDGMTYGSRGHFLGGYE
MYGTKRNEPDDEIRKVRDNIRRVKGILLSTRSFPSSTR*
Coding >Ophun1|2121
ATGGACGACTCAGAAGATTCCGAGTCGCACAGTCAAAGCGATCACAACCAGCCGTCTCAATCCGCAGCCACACAG
CCGCAAGACCAACTCCATACCGCGCGTCGCTTCCTACAAGACGACCATGTGAAGACGGCATCTCTAGAGGAGAAA
GCCAGCTTCCTCAAATCCAAGGGTGTTTCCGACGGAGATATTCAGAAACTACTAGCTGAACTTGAATCGTCAAGT
CGTCAAACAGAGACTGCCGAGCCAGAACCTCAATCACCAACTAATACCCCGAATCGCCCTGCCAACTCCCACCCA
TCAGAAGAAACCGAAACAGACCGTCCCCCCATCGTCACATACCCCGAGTTCCTCGCCAAACCCGCAAGACCACCA
CCCCTCGTCACAACCACCCGCCTCCTAAACACCGTCTATGGCTTCGCCGGCTTCGCAACGCTCCTCTACGGCACG
AGCAAGTACTATCTCGCCCCCATGGTCGACGACCTAACAGAAGCCCGCTCCAATCTATACACTACCGCGACCAGC
AAACTCCTCGCTCTCATCCCGACTCTGGAAAAGTCCGTCTCCGTCATCCCTCCCACCGCCAGCCATTCCGCCCCC
GCAGACGATGCCAGCGACGCCGAAGACCCCTCCGAGATGTTCCACCGCGATGTCGGCACTCAGACTTCCCTCCCC
GATAGCCCTGCCGGCACCGCTCAGGTTCGCCCCGTTGCGGGTTCACCATCCGACCGTCAGGCTGATCGCCTCTCC
GACGCTGTCCGTACCCTCTCTGGTCTCAAGGACGACTTTCGTTCGCAGTGCGATCATCTAGAGGACTTGCGGACG
CTGCTCGACGTGCTACGTGACGATCTCGACGGTATGACATACGGGAGCAGAGGACACTTCCTCGGCGGATACGAA
ATGTACGGCACGAAGAGAAACGAGCCCGATGACGAGATCCGGAAGGTCCGCGACAACATCAGAAGAGTCAAAGGC
ATTCTGCTCAGTACTCGAAGCTTCCCTTCCTCCACCAGATGA
Transcript >Ophun1|2121
ATGGACGACTCAGAAGATTCCGAGTCGCACAGTCAAAGCGATCACAACCAGCCGTCTCAATCCGCAGCCACACAG
CCGCAAGACCAACTCCATACCGCGCGTCGCTTCCTACAAGACGACCATGTGAAGACGGCATCTCTAGAGGAGAAA
GCCAGCTTCCTCAAATCCAAGGGTGTTTCCGACGGAGATATTCAGAAACTACTAGCTGAACTTGAATCGTCAAGT
CGTCAAACAGAGACTGCCGAGCCAGAACCTCAATCACCAACTAATACCCCGAATCGCCCTGCCAACTCCCACCCA
TCAGAAGAAACCGAAACAGACCGTCCCCCCATCGTCACATACCCCGAGTTCCTCGCCAAACCCGCAAGACCACCA
CCCCTCGTCACAACCACCCGCCTCCTAAACACCGTCTATGGCTTCGCCGGCTTCGCAACGCTCCTCTACGGCACG
AGCAAGTACTATCTCGCCCCCATGGTCGACGACCTAACAGAAGCCCGCTCCAATCTATACACTACCGCGACCAGC
AAACTCCTCGCTCTCATCCCGACTCTGGAAAAGTCCGTCTCCGTCATCCCTCCCACCGCCAGCCATTCCGCCCCC
GCAGACGATGCCAGCGACGCCGAAGACCCCTCCGAGATGTTCCACCGCGATGTCGGCACTCAGACTTCCCTCCCC
GATAGCCCTGCCGGCACCGCTCAGGTTCGCCCCGTTGCGGGTTCACCATCCGACCGTCAGGCTGATCGCCTCTCC
GACGCTGTCCGTACCCTCTCTGGTCTCAAGGACGACTTTCGTTCGCAGTGCGATCATCTAGAGGACTTGCGGACG
CTGCTCGACGTGCTACGTGACGATCTCGACGGTATGACATACGGGAGCAGAGGACACTTCCTCGGCGGATACGAA
ATGTACGGCACGAAGAGAAACGAGCCCGATGACGAGATCCGGAAGGTCCGCGACAACATCAGAAGAGTCAAAGGC
ATTCTGCTCAGTACTCGAAGCTTCCCTTCCTCCACCAGATGA
Gene >Ophun1|2121
ATGGACGACTCAGAAGATTCCGAGTCGCACAGTCAAAGCGATCACAACCAGCCGTCTCAATCCGCAGCCACACAG
CCGCAAGACCAACTCCATACCGCGCGTCGCTTCCTACAAGACGACCATGTGAAGACGGCATCTCTAGAGGAGAAA
GCCAGCTTCCTCAAATCCAAGGGTGTTTCCGACGGAGATATTCAGAAACTACTAGCTGAACTTGAATCGTCAAGT
CGTCAAACAGAGGTTCGTCTCCCATACAGTTCCAGGTCATCCAACCTCTTCACAACTTCTTACTTACACCACCCA
GACTGCCGAGCCAGAACCTCAATCACCAACTAATACCCCGAATCGCCCTGCCAACTCCCACCCATCAGAAGAAAC
CGAAACAGACCGTCCCCCCATCGTCACATACCCCGAGTTCCTCGCCAAACCCGCAAGACCACCACCCCTCGTCAC
AACCACCCGCCTCCTAAACACCGTCTATGGCTTCGCCGGCTTCGCAACGCTCCTCTACGGCACGAGCAAGTACTA
TCTCGCCCCCATGGTCGACGACCTAACAGAAGCCCGCTCCAATCTATACACTACCGCGACCAGCAAACTCCTCGC
TCTCATCCCGACTCTGGAAAAGTCCGTCTCCGTCATCCCTCCCACCGCCAGCCATTCCGCCCCCGCAGACGATGC
CAGCGACGCCGAAGACCCCTCCGAGATGTTCCACCGCGATGTCGGCACTCAGACTTCCCTCCCCGATAGCCCTGC
CGGCACCGCTCAGGTTCGCCCCGTTGCGGGTTCACCATCCGACCGTCAGGCTGATCGCCTCTCCGACGCTGTCCG
TACCCTCTCTGGTCTCAAGGACGACTTTCGTTCGCAGTGCGATCATCTAGAGGACTTGCGGACGCTGCTCGACGT
GCTACGTGACGATCTCGACGGTATGACATACGGGAGCAGAGGACACTTCCTCGGCGGATACGAAATGTACGGCAC
GAAGAGAAACGAGCCCGATGACGAGATCCGGAAGGTCCGCGACAACATCAGAAGAGTCAAAGGCATTCTGCTCAG
TACTCGAAGCTTCCCTTCCTCCACCAGATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail