Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|212
Gene name
LocationContig_1040:1211..1805
Strand-
Gene length (bp)594
Transcript length (bp)594
Coding sequence length (bp)594
Protein length (aa) 198

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14475 Mso1_Sec1_bdg Sec1-binding region of Mso1 2.2E-18 18 57

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup6343
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4916
Ophiocordyceps australis map64 (Brazil) OphauB2|1664
Ophiocordyceps camponoti-floridani Ophcf2|05339
Ophiocordyceps camponoti-rufipedis Ophun1|212 (this protein)
Ophiocordyceps kimflemingae Ophio5|4912

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|212
MASWYSSILTKTTSHISSLRATLLSSDADGDDDDDTHVCRVLRNYYADKGRPLPSWLPPDPKAPAPVAAPAPTQQ
VAPVGSRYGVPQSQSQPGGGLSSLWDSGGQQQQQQQRQQQQQQQRGGSAGNPSLGPPRPNLGAQRAGSYQAGGTA
SSSAQDRLRQRMRGTGPGRTASPQGQNGFAPPERGRGLPADPRGGYR*
Coding >Ophun1|212
ATGGCGTCGTGGTACTCCTCCATCCTCACAAAAACAACCTCGCACATCTCCTCCCTCCGCGCAACCCTCCTCTCC
TCCGACGCAGACGGCGACGACGACGACGATACCCACGTCTGCCGCGTCCTCCGAAATTACTACGCTGACAAAGGC
CGGCCCCTCCCTTCCTGGCTGCCCCCCGATCCCAAGGCCCCGGCCCCCGTTGCAGCCCCCGCGCCGACGCAGCAG
GTCGCCCCCGTGGGATCACGATACGGCGTTCCGCAGTCGCAGTCGCAGCCGGGCGGTGGTCTGAGCAGTCTGTGG
GATAGCGGGGGGCAACAGCAGCAGCAACAGCAGCGGCAGCAGCAGCAGCAGCAGCAGAGGGGGGGCAGCGCTGGG
AATCCAAGCCTTGGGCCTCCGAGGCCGAATCTGGGGGCTCAGAGGGCGGGGTCGTACCAGGCTGGAGGGACGGCG
TCTTCGTCGGCGCAGGATAGGCTGAGGCAGAGGATGAGGGGGACCGGGCCGGGGAGGACGGCGAGTCCGCAGGGG
CAGAATGGGTTTGCGCCGCCCGAGAGGGGGAGGGGGTTGCCGGCGGATCCGAGGGGGGGGTATCGGTGA
Transcript >Ophun1|212
ATGGCGTCGTGGTACTCCTCCATCCTCACAAAAACAACCTCGCACATCTCCTCCCTCCGCGCAACCCTCCTCTCC
TCCGACGCAGACGGCGACGACGACGACGATACCCACGTCTGCCGCGTCCTCCGAAATTACTACGCTGACAAAGGC
CGGCCCCTCCCTTCCTGGCTGCCCCCCGATCCCAAGGCCCCGGCCCCCGTTGCAGCCCCCGCGCCGACGCAGCAG
GTCGCCCCCGTGGGATCACGATACGGCGTTCCGCAGTCGCAGTCGCAGCCGGGCGGTGGTCTGAGCAGTCTGTGG
GATAGCGGGGGGCAACAGCAGCAGCAACAGCAGCGGCAGCAGCAGCAGCAGCAGCAGAGGGGGGGCAGCGCTGGG
AATCCAAGCCTTGGGCCTCCGAGGCCGAATCTGGGGGCTCAGAGGGCGGGGTCGTACCAGGCTGGAGGGACGGCG
TCTTCGTCGGCGCAGGATAGGCTGAGGCAGAGGATGAGGGGGACCGGGCCGGGGAGGACGGCGAGTCCGCAGGGG
CAGAATGGGTTTGCGCCGCCCGAGAGGGGGAGGGGGTTGCCGGCGGATCCGAGGGGGGGGTATCGGTGA
Gene >Ophun1|212
ATGGCGTCGTGGTACTCCTCCATCCTCACAAAAACAACCTCGCACATCTCCTCCCTCCGCGCAACCCTCCTCTCC
TCCGACGCAGACGGCGACGACGACGACGATACCCACGTCTGCCGCGTCCTCCGAAATTACTACGCTGACAAAGGC
CGGCCCCTCCCTTCCTGGCTGCCCCCCGATCCCAAGGCCCCGGCCCCCGTTGCAGCCCCCGCGCCGACGCAGCAG
GTCGCCCCCGTGGGATCACGATACGGCGTTCCGCAGTCGCAGTCGCAGCCGGGCGGTGGTCTGAGCAGTCTGTGG
GATAGCGGGGGGCAACAGCAGCAGCAACAGCAGCGGCAGCAGCAGCAGCAGCAGCAGAGGGGGGGCAGCGCTGGG
AATCCAAGCCTTGGGCCTCCGAGGCCGAATCTGGGGGCTCAGAGGGCGGGGTCGTACCAGGCTGGAGGGACGGCG
TCTTCGTCGGCGCAGGATAGGCTGAGGCAGAGGATGAGGGGGACCGGGCCGGGGAGGACGGCGAGTCCGCAGGGG
CAGAATGGGTTTGCGCCGCCCGAGAGGGGGAGGGGGTTGCCGGCGGATCCGAGGGGGGGGTATCGGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail