Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2115
Gene name
LocationContig_2:87459..89526
Strand+
Gene length (bp)2067
Transcript length (bp)2067
Coding sequence length (bp)2067
Protein length (aa) 689

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2058
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3337
Ophiocordyceps australis map64 (Brazil) OphauB2|2518
Ophiocordyceps camponoti-floridani Ophcf2|04298
Ophiocordyceps camponoti-rufipedis Ophun1|2115 (this protein)
Ophiocordyceps kimflemingae Ophio5|1393
Ophiocordyceps subramaniannii Hirsu2|2372

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2115
MVATRKSARSDTRGAHRRKSGRVSRQRRRASSSSSNNDDQGSDFQPDDDAPYPSRKENKRGRKRRTPPIDVDVDF
DDAISTPSGPSRRGSQEPQAKSRQPATLPDEPESTSLIPNWKDPRITFDCWTSIFSYAATSASADGLSTSWLVQA
ATTCHAFAEPALTALYRCPTIKTTLKAKRLAALLDRPPSETLFNYRVKVETLYINVHIVPQALMYQLVHPLGRLK
ELLIYTPLDQPPYRELETTLRWLYTEDVFRSLAAAEADSSKAEAKSFPTMLKSWEWSGRFIGGYVSDAMSLVSIH
DSWSFSSLTKLSFTNFQLPSLNNVRLRPDSDEEALRAEQEDGRMVEAVALAISRLKYLDHLVFESSTVLNDRLLP
LLPKNLAHLELINCWEVNSEDLAEFLTTHGSRLRTLNLMHNQSLDLSFLTTLSETCPNLRELRINMSYYRHHESF
NDSDPMYAWALLPTQIPQWPPSLRVISIEHIGNWSVEAAQVFFQSLIDSAPRLPCLRHLSIKTRLDIPWQLRATM
RREWRTTMEKVFLRPTASPRPHTSLHPPMADDVQPPRAPKRRRTTATSPPSRRSGRIAAANVGSRISSSKRLRHR
QQARPSYKDPDTDEDEAYEEDTDDGDAQNVSSAASADGESGPAIQGLCETVNIQFDNQKVRELQWGMEDFVDLDE
KAESEDEWEGDED*
Coding >Ophun1|2115
ATGGTGGCCACCCGCAAATCGGCACGGTCCGACACCCGGGGCGCTCACCGCCGGAAGTCCGGGCGCGTCTCTCGC
CAGCGTCGACGAGCATCATCATCTTCGTCCAACAACGATGACCAAGGAAGCGATTTCCAACCGGACGACGACGCC
CCCTATCCGAGTCGCAAAGAGAATAAACGCGGCAGAAAGCGTCGCACGCCTCCAATAGATGTCGATGTCGACTTC
GACGACGCAATTTCTACCCCATCGGGGCCGTCTCGACGAGGCTCTCAGGAACCGCAAGCCAAGAGTCGTCAGCCG
GCTACGCTCCCAGACGAACCTGAATCAACCAGTCTGATCCCGAACTGGAAGGATCCGCGCATCACCTTTGACTGC
TGGACAAGCATCTTCTCCTATGCCGCGACCTCAGCATCGGCCGATGGCCTCTCCACAAGCTGGCTCGTTCAAGCT
GCCACTACATGTCACGCTTTTGCCGAGCCGGCGCTGACGGCGCTCTACCGATGTCCTACAATCAAAACCACATTG
AAAGCCAAGCGTCTCGCAGCCTTACTCGACCGCCCTCCTTCGGAAACCCTCTTTAATTATCGAGTCAAGGTCGAG
ACCCTGTATATCAACGTTCACATCGTCCCCCAGGCCCTCATGTACCAGCTAGTACATCCTCTGGGACGGCTCAAG
GAGCTCCTCATCTACACTCCATTGGATCAGCCGCCCTACAGAGAGCTGGAAACTACCCTCCGATGGCTGTACACG
GAAGACGTCTTTCGCTCACTGGCAGCTGCGGAAGCGGACTCGAGCAAGGCCGAAGCCAAGTCGTTTCCCACAATG
CTCAAGAGCTGGGAGTGGAGTGGGAGGTTCATCGGCGGCTACGTTTCTGATGCAATGTCCTTGGTCTCGATTCAC
GACTCATGGTCCTTCTCGTCGCTCACCAAACTGAGCTTTACCAATTTTCAACTGCCATCTTTAAACAATGTGCGG
CTCAGGCCAGATAGCGACGAGGAAGCGCTTCGAGCTGAACAAGAGGATGGCCGGATGGTTGAGGCCGTTGCCCTT
GCCATTTCACGCTTGAAATACCTCGACCATCTGGTGTTTGAGTCTTCAACCGTATTGAATGACCGCCTGCTCCCT
CTGTTGCCCAAGAACCTCGCCCATCTAGAGCTCATCAACTGCTGGGAAGTCAACTCGGAGGATCTCGCAGAATTC
CTCACCACGCACGGCAGCAGGCTACGAACCTTGAACCTCATGCACAACCAATCCTTGGACCTGAGCTTCCTGACC
ACCTTATCCGAAACGTGCCCCAACCTCCGAGAACTCCGCATCAACATGTCGTACTACCGTCACCACGAAAGCTTC
AACGATTCGGATCCCATGTACGCCTGGGCCCTTCTCCCGACCCAAATCCCGCAATGGCCGCCCAGCCTCCGGGTG
ATAAGCATCGAGCACATAGGCAACTGGAGCGTCGAGGCCGCACAGGTCTTCTTCCAATCTCTCATCGACAGCGCC
CCGAGACTGCCCTGCCTCCGTCACCTCTCCATCAAGACCAGACTCGACATACCCTGGCAACTCCGTGCGACGATG
CGTCGCGAATGGCGCACCACCATGGAAAAAGTCTTCCTCCGTCCCACCGCCTCCCCCCGGCCGCACACCAGCCTT
CACCCGCCGATGGCGGATGACGTCCAACCGCCGCGAGCTCCCAAGAGGCGTCGCACCACGGCAACCAGCCCTCCC
TCTCGCCGAAGCGGGAGGATTGCAGCCGCCAACGTCGGCAGTCGCATCTCGTCTAGCAAACGTCTCCGCCACCGC
CAACAGGCAAGACCCTCGTACAAGGACCCGGACACGGACGAAGACGAGGCCTACGAGGAAGACACAGATGATGGA
GACGCCCAGAACGTCTCTTCCGCCGCCTCGGCCGACGGAGAAAGCGGGCCGGCCATCCAGGGCCTCTGCGAAACC
GTCAACATCCAATTCGACAACCAAAAGGTCCGCGAGCTGCAGTGGGGCATGGAAGACTTTGTCGACCTCGACGAA
AAGGCAGAGTCGGAGGATGAATGGGAGGGAGACGAGGATTAA
Transcript >Ophun1|2115
ATGGTGGCCACCCGCAAATCGGCACGGTCCGACACCCGGGGCGCTCACCGCCGGAAGTCCGGGCGCGTCTCTCGC
CAGCGTCGACGAGCATCATCATCTTCGTCCAACAACGATGACCAAGGAAGCGATTTCCAACCGGACGACGACGCC
CCCTATCCGAGTCGCAAAGAGAATAAACGCGGCAGAAAGCGTCGCACGCCTCCAATAGATGTCGATGTCGACTTC
GACGACGCAATTTCTACCCCATCGGGGCCGTCTCGACGAGGCTCTCAGGAACCGCAAGCCAAGAGTCGTCAGCCG
GCTACGCTCCCAGACGAACCTGAATCAACCAGTCTGATCCCGAACTGGAAGGATCCGCGCATCACCTTTGACTGC
TGGACAAGCATCTTCTCCTATGCCGCGACCTCAGCATCGGCCGATGGCCTCTCCACAAGCTGGCTCGTTCAAGCT
GCCACTACATGTCACGCTTTTGCCGAGCCGGCGCTGACGGCGCTCTACCGATGTCCTACAATCAAAACCACATTG
AAAGCCAAGCGTCTCGCAGCCTTACTCGACCGCCCTCCTTCGGAAACCCTCTTTAATTATCGAGTCAAGGTCGAG
ACCCTGTATATCAACGTTCACATCGTCCCCCAGGCCCTCATGTACCAGCTAGTACATCCTCTGGGACGGCTCAAG
GAGCTCCTCATCTACACTCCATTGGATCAGCCGCCCTACAGAGAGCTGGAAACTACCCTCCGATGGCTGTACACG
GAAGACGTCTTTCGCTCACTGGCAGCTGCGGAAGCGGACTCGAGCAAGGCCGAAGCCAAGTCGTTTCCCACAATG
CTCAAGAGCTGGGAGTGGAGTGGGAGGTTCATCGGCGGCTACGTTTCTGATGCAATGTCCTTGGTCTCGATTCAC
GACTCATGGTCCTTCTCGTCGCTCACCAAACTGAGCTTTACCAATTTTCAACTGCCATCTTTAAACAATGTGCGG
CTCAGGCCAGATAGCGACGAGGAAGCGCTTCGAGCTGAACAAGAGGATGGCCGGATGGTTGAGGCCGTTGCCCTT
GCCATTTCACGCTTGAAATACCTCGACCATCTGGTGTTTGAGTCTTCAACCGTATTGAATGACCGCCTGCTCCCT
CTGTTGCCCAAGAACCTCGCCCATCTAGAGCTCATCAACTGCTGGGAAGTCAACTCGGAGGATCTCGCAGAATTC
CTCACCACGCACGGCAGCAGGCTACGAACCTTGAACCTCATGCACAACCAATCCTTGGACCTGAGCTTCCTGACC
ACCTTATCCGAAACGTGCCCCAACCTCCGAGAACTCCGCATCAACATGTCGTACTACCGTCACCACGAAAGCTTC
AACGATTCGGATCCCATGTACGCCTGGGCCCTTCTCCCGACCCAAATCCCGCAATGGCCGCCCAGCCTCCGGGTG
ATAAGCATCGAGCACATAGGCAACTGGAGCGTCGAGGCCGCACAGGTCTTCTTCCAATCTCTCATCGACAGCGCC
CCGAGACTGCCCTGCCTCCGTCACCTCTCCATCAAGACCAGACTCGACATACCCTGGCAACTCCGTGCGACGATG
CGTCGCGAATGGCGCACCACCATGGAAAAAGTCTTCCTCCGTCCCACCGCCTCCCCCCGGCCGCACACCAGCCTT
CACCCGCCGATGGCGGATGACGTCCAACCGCCGCGAGCTCCCAAGAGGCGTCGCACCACGGCAACCAGCCCTCCC
TCTCGCCGAAGCGGGAGGATTGCAGCCGCCAACGTCGGCAGTCGCATCTCGTCTAGCAAACGTCTCCGCCACCGC
CAACAGGCAAGACCCTCGTACAAGGACCCGGACACGGACGAAGACGAGGCCTACGAGGAAGACACAGATGATGGA
GACGCCCAGAACGTCTCTTCCGCCGCCTCGGCCGACGGAGAAAGCGGGCCGGCCATCCAGGGCCTCTGCGAAACC
GTCAACATCCAATTCGACAACCAAAAGGTCCGCGAGCTGCAGTGGGGCATGGAAGACTTTGTCGACCTCGACGAA
AAGGCAGAGTCGGAGGATGAATGGGAGGGAGACGAGGATTAA
Gene >Ophun1|2115
ATGGTGGCCACCCGCAAATCGGCACGGTCCGACACCCGGGGCGCTCACCGCCGGAAGTCCGGGCGCGTCTCTCGC
CAGCGTCGACGAGCATCATCATCTTCGTCCAACAACGATGACCAAGGAAGCGATTTCCAACCGGACGACGACGCC
CCCTATCCGAGTCGCAAAGAGAATAAACGCGGCAGAAAGCGTCGCACGCCTCCAATAGATGTCGATGTCGACTTC
GACGACGCAATTTCTACCCCATCGGGGCCGTCTCGACGAGGCTCTCAGGAACCGCAAGCCAAGAGTCGTCAGCCG
GCTACGCTCCCAGACGAACCTGAATCAACCAGTCTGATCCCGAACTGGAAGGATCCGCGCATCACCTTTGACTGC
TGGACAAGCATCTTCTCCTATGCCGCGACCTCAGCATCGGCCGATGGCCTCTCCACAAGCTGGCTCGTTCAAGCT
GCCACTACATGTCACGCTTTTGCCGAGCCGGCGCTGACGGCGCTCTACCGATGTCCTACAATCAAAACCACATTG
AAAGCCAAGCGTCTCGCAGCCTTACTCGACCGCCCTCCTTCGGAAACCCTCTTTAATTATCGAGTCAAGGTCGAG
ACCCTGTATATCAACGTTCACATCGTCCCCCAGGCCCTCATGTACCAGCTAGTACATCCTCTGGGACGGCTCAAG
GAGCTCCTCATCTACACTCCATTGGATCAGCCGCCCTACAGAGAGCTGGAAACTACCCTCCGATGGCTGTACACG
GAAGACGTCTTTCGCTCACTGGCAGCTGCGGAAGCGGACTCGAGCAAGGCCGAAGCCAAGTCGTTTCCCACAATG
CTCAAGAGCTGGGAGTGGAGTGGGAGGTTCATCGGCGGCTACGTTTCTGATGCAATGTCCTTGGTCTCGATTCAC
GACTCATGGTCCTTCTCGTCGCTCACCAAACTGAGCTTTACCAATTTTCAACTGCCATCTTTAAACAATGTGCGG
CTCAGGCCAGATAGCGACGAGGAAGCGCTTCGAGCTGAACAAGAGGATGGCCGGATGGTTGAGGCCGTTGCCCTT
GCCATTTCACGCTTGAAATACCTCGACCATCTGGTGTTTGAGTCTTCAACCGTATTGAATGACCGCCTGCTCCCT
CTGTTGCCCAAGAACCTCGCCCATCTAGAGCTCATCAACTGCTGGGAAGTCAACTCGGAGGATCTCGCAGAATTC
CTCACCACGCACGGCAGCAGGCTACGAACCTTGAACCTCATGCACAACCAATCCTTGGACCTGAGCTTCCTGACC
ACCTTATCCGAAACGTGCCCCAACCTCCGAGAACTCCGCATCAACATGTCGTACTACCGTCACCACGAAAGCTTC
AACGATTCGGATCCCATGTACGCCTGGGCCCTTCTCCCGACCCAAATCCCGCAATGGCCGCCCAGCCTCCGGGTG
ATAAGCATCGAGCACATAGGCAACTGGAGCGTCGAGGCCGCACAGGTCTTCTTCCAATCTCTCATCGACAGCGCC
CCGAGACTGCCCTGCCTCCGTCACCTCTCCATCAAGACCAGACTCGACATACCCTGGCAACTCCGTGCGACGATG
CGTCGCGAATGGCGCACCACCATGGAAAAAGTCTTCCTCCGTCCCACCGCCTCCCCCCGGCCGCACACCAGCCTT
CACCCGCCGATGGCGGATGACGTCCAACCGCCGCGAGCTCCCAAGAGGCGTCGCACCACGGCAACCAGCCCTCCC
TCTCGCCGAAGCGGGAGGATTGCAGCCGCCAACGTCGGCAGTCGCATCTCGTCTAGCAAACGTCTCCGCCACCGC
CAACAGGCAAGACCCTCGTACAAGGACCCGGACACGGACGAAGACGAGGCCTACGAGGAAGACACAGATGATGGA
GACGCCCAGAACGTCTCTTCCGCCGCCTCGGCCGACGGAGAAAGCGGGCCGGCCATCCAGGGCCTCTGCGAAACC
GTCAACATCCAATTCGACAACCAAAAGGTCCGCGAGCTGCAGTGGGGCATGGAAGACTTTGTCGACCTCGACGAA
AAGGCAGAGTCGGAGGATGAATGGGAGGGAGACGAGGATTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail