Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2114
Gene name
LocationContig_2:84133..86230
Strand-
Gene length (bp)2097
Transcript length (bp)2097
Coding sequence length (bp)2097
Protein length (aa) 699

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09733 VEFS-Box VEFS-Box of polycomb protein 1.1E-05 528 623

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1978
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2448
Ophiocordyceps australis map64 (Brazil) OphauB2|2517
Ophiocordyceps camponoti-floridani Ophcf2|04297
Ophiocordyceps camponoti-rufipedis Ophun1|2114 (this protein)
Ophiocordyceps kimflemingae Ophio5|1392
Ophiocordyceps subramaniannii Hirsu2|2172

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2114
MTVHSPCQRTAPFLHRTWLKGVRAFQESSAMGNMTSSAVKGPLPRHADGPSPAKRRRFTSPDSFELDRLLAAPQM
AELGSALRIEVLKIFHKDSKKVRSVQTSTIPHDFTITKARCRITIFDTSSDQPQVLDRQSKLCDLVTFKNPVGPH
RVARVDLPRPFVVPHESILINRPEDGRLDLSDSYQLLVELEAANGSRWPPLDTNDFGLSSAMPFPQADSTQHWIL
SSRFDSVVGRLKNSLDLTARLSPQQPPLETDYVMDVDLRWAAGLKALKHADKDSKPCITAIDPEVHSCRFADFQR
PNGHGNGNGETSVEPDDESVLGHTPSRSLRTREKEKVYNLKVLSDQAHGRDRTKRGRSGSVTTTVEGRVQYLLPA
DQPVCLDYFRCVSCGAFHESMTELQTHLRTVHTAYDYVFESTSQGPQFQVSARRETCIKPHGFGRQVRPFHLYTH
DQVCVTSRPALENEAYSNLSPSRPERLQSGSPALKGSKPLIQRRPRKQKVVKAVVPDIPHPLYHPISRARLNPGD
EVPETEPDNTWLIQRHRDSIAEFSDVTPAEKEYIWEWDGYILGKNLTSLAYFPREWLGFVREKATWLVSEKRRML
EFAKHSSALLARNLLNDTMMEDAFAMIDKARAALKQQARQDEAEEQQQQPSAGAASPRQSPKVRKSASGCVVCQL
PVLGPTMLICSNTVGIPSRPLPG*
Coding >Ophun1|2114
ATGACGGTACACAGCCCCTGCCAGCGGACAGCCCCCTTCCTCCACCGTACCTGGCTCAAGGGAGTCCGAGCCTTC
CAGGAATCCTCTGCCATGGGCAACATGACTTCGTCCGCCGTCAAGGGTCCGCTGCCACGCCACGCGGATGGACCT
AGCCCGGCCAAGCGCCGCCGCTTCACGTCGCCCGACTCGTTCGAGCTGGACCGTCTGCTCGCGGCCCCTCAGATG
GCCGAACTAGGCTCGGCCCTGCGCATTGAGGTGCTCAAGATCTTTCACAAGGACTCCAAAAAGGTCAGGTCGGTG
CAGACCTCGACCATCCCCCACGACTTCACCATCACCAAGGCCCGCTGCAGGATCACAATTTTCGACACCAGCTCC
GATCAGCCCCAGGTCCTTGACCGCCAGAGCAAGCTCTGCGACCTGGTAACTTTCAAAAATCCCGTGGGCCCTCAT
CGCGTCGCCCGCGTCGATCTGCCGCGCCCTTTCGTCGTCCCCCATGAGAGCATCCTCATCAACAGGCCGGAAGAT
GGCAGGCTTGATCTATCCGACTCGTACCAGCTCCTGGTCGAGCTGGAAGCCGCCAACGGGAGTCGCTGGCCTCCG
CTCGACACCAATGATTTCGGCCTCTCATCCGCAATGCCTTTTCCCCAGGCAGACTCGACCCAGCATTGGATCTTG
TCCAGCCGCTTCGACAGCGTCGTCGGCAGGCTAAAGAACTCGCTCGATCTGACGGCCAGGCTGTCCCCGCAACAG
CCACCCTTGGAGACTGATTATGTCATGGACGTTGACCTTCGATGGGCGGCAGGTCTTAAAGCGCTCAAACATGCC
GACAAGGACTCAAAACCGTGCATTACGGCTATCGATCCCGAGGTCCATTCCTGTCGTTTCGCAGATTTTCAACGC
CCCAACGGCCATGGCAATGGCAATGGGGAAACCTCTGTCGAACCAGATGACGAGTCTGTACTTGGTCATACGCCG
TCCCGCTCATTAAGGACGCGAGAAAAGGAAAAGGTGTACAATTTGAAAGTCTTGAGCGACCAGGCACACGGCAGA
GACCGGACAAAACGCGGCAGAAGCGGCAGCGTGACGACGACCGTCGAGGGTCGCGTCCAGTATCTCTTGCCGGCC
GATCAGCCCGTCTGCCTCGACTATTTCCGCTGCGTCAGCTGCGGTGCGTTCCACGAGTCCATGACCGAGCTGCAG
ACTCATCTCCGCACCGTCCACACAGCCTACGACTATGTTTTCGAGTCGACGAGTCAGGGGCCGCAGTTCCAAGTC
TCTGCTCGGCGTGAAACTTGCATCAAGCCGCACGGTTTCGGACGCCAAGTCCGGCCCTTTCACCTCTATACCCAC
GATCAGGTATGCGTTACGTCGCGTCCTGCCTTGGAAAATGAAGCCTACAGCAACCTGTCTCCGTCCAGGCCCGAG
CGACTGCAGTCTGGGTCGCCGGCCCTCAAGGGCTCCAAGCCCCTGATACAGCGTCGTCCGCGGAAACAAAAGGTT
GTCAAGGCCGTGGTGCCAGATATACCTCACCCGCTTTATCACCCCATTAGCAGGGCGCGCCTGAACCCCGGCGAT
GAGGTGCCAGAGACGGAGCCGGACAACACGTGGCTTATTCAGAGGCACCGAGACAGCATAGCCGAATTCTCTGAC
GTGACGCCGGCCGAGAAGGAGTACATTTGGGAATGGGACGGGTACATCCTCGGCAAGAACCTCACATCGCTCGCC
TACTTCCCGCGCGAGTGGCTCGGTTTCGTGCGAGAAAAGGCGACATGGCTCGTGTCGGAAAAGCGACGGATGCTG
GAGTTTGCGAAGCACTCGAGCGCCTTGCTGGCCCGCAACCTCTTGAACGACACGATGATGGAAGACGCCTTCGCC
ATGATTGATAAAGCGAGAGCCGCGCTGAAGCAGCAGGCCCGTCAAGACGAAGCAGAAGAGCAGCAGCAGCAGCCG
TCAGCCGGAGCCGCGAGCCCAAGACAGTCGCCCAAGGTTCGCAAGAGCGCCAGCGGCTGCGTTGTGTGTCAGTTG
CCGGTTCTCGGCCCGACGATGCTGATATGCTCCAACACGGTGGGTATCCCGTCTCGTCCCTTGCCTGGCTGA
Transcript >Ophun1|2114
ATGACGGTACACAGCCCCTGCCAGCGGACAGCCCCCTTCCTCCACCGTACCTGGCTCAAGGGAGTCCGAGCCTTC
CAGGAATCCTCTGCCATGGGCAACATGACTTCGTCCGCCGTCAAGGGTCCGCTGCCACGCCACGCGGATGGACCT
AGCCCGGCCAAGCGCCGCCGCTTCACGTCGCCCGACTCGTTCGAGCTGGACCGTCTGCTCGCGGCCCCTCAGATG
GCCGAACTAGGCTCGGCCCTGCGCATTGAGGTGCTCAAGATCTTTCACAAGGACTCCAAAAAGGTCAGGTCGGTG
CAGACCTCGACCATCCCCCACGACTTCACCATCACCAAGGCCCGCTGCAGGATCACAATTTTCGACACCAGCTCC
GATCAGCCCCAGGTCCTTGACCGCCAGAGCAAGCTCTGCGACCTGGTAACTTTCAAAAATCCCGTGGGCCCTCAT
CGCGTCGCCCGCGTCGATCTGCCGCGCCCTTTCGTCGTCCCCCATGAGAGCATCCTCATCAACAGGCCGGAAGAT
GGCAGGCTTGATCTATCCGACTCGTACCAGCTCCTGGTCGAGCTGGAAGCCGCCAACGGGAGTCGCTGGCCTCCG
CTCGACACCAATGATTTCGGCCTCTCATCCGCAATGCCTTTTCCCCAGGCAGACTCGACCCAGCATTGGATCTTG
TCCAGCCGCTTCGACAGCGTCGTCGGCAGGCTAAAGAACTCGCTCGATCTGACGGCCAGGCTGTCCCCGCAACAG
CCACCCTTGGAGACTGATTATGTCATGGACGTTGACCTTCGATGGGCGGCAGGTCTTAAAGCGCTCAAACATGCC
GACAAGGACTCAAAACCGTGCATTACGGCTATCGATCCCGAGGTCCATTCCTGTCGTTTCGCAGATTTTCAACGC
CCCAACGGCCATGGCAATGGCAATGGGGAAACCTCTGTCGAACCAGATGACGAGTCTGTACTTGGTCATACGCCG
TCCCGCTCATTAAGGACGCGAGAAAAGGAAAAGGTGTACAATTTGAAAGTCTTGAGCGACCAGGCACACGGCAGA
GACCGGACAAAACGCGGCAGAAGCGGCAGCGTGACGACGACCGTCGAGGGTCGCGTCCAGTATCTCTTGCCGGCC
GATCAGCCCGTCTGCCTCGACTATTTCCGCTGCGTCAGCTGCGGTGCGTTCCACGAGTCCATGACCGAGCTGCAG
ACTCATCTCCGCACCGTCCACACAGCCTACGACTATGTTTTCGAGTCGACGAGTCAGGGGCCGCAGTTCCAAGTC
TCTGCTCGGCGTGAAACTTGCATCAAGCCGCACGGTTTCGGACGCCAAGTCCGGCCCTTTCACCTCTATACCCAC
GATCAGGTATGCGTTACGTCGCGTCCTGCCTTGGAAAATGAAGCCTACAGCAACCTGTCTCCGTCCAGGCCCGAG
CGACTGCAGTCTGGGTCGCCGGCCCTCAAGGGCTCCAAGCCCCTGATACAGCGTCGTCCGCGGAAACAAAAGGTT
GTCAAGGCCGTGGTGCCAGATATACCTCACCCGCTTTATCACCCCATTAGCAGGGCGCGCCTGAACCCCGGCGAT
GAGGTGCCAGAGACGGAGCCGGACAACACGTGGCTTATTCAGAGGCACCGAGACAGCATAGCCGAATTCTCTGAC
GTGACGCCGGCCGAGAAGGAGTACATTTGGGAATGGGACGGGTACATCCTCGGCAAGAACCTCACATCGCTCGCC
TACTTCCCGCGCGAGTGGCTCGGTTTCGTGCGAGAAAAGGCGACATGGCTCGTGTCGGAAAAGCGACGGATGCTG
GAGTTTGCGAAGCACTCGAGCGCCTTGCTGGCCCGCAACCTCTTGAACGACACGATGATGGAAGACGCCTTCGCC
ATGATTGATAAAGCGAGAGCCGCGCTGAAGCAGCAGGCCCGTCAAGACGAAGCAGAAGAGCAGCAGCAGCAGCCG
TCAGCCGGAGCCGCGAGCCCAAGACAGTCGCCCAAGGTTCGCAAGAGCGCCAGCGGCTGCGTTGTGTGTCAGTTG
CCGGTTCTCGGCCCGACGATGCTGATATGCTCCAACACGGTGGGTATCCCGTCTCGTCCCTTGCCTGGCTGA
Gene >Ophun1|2114
ATGACGGTACACAGCCCCTGCCAGCGGACAGCCCCCTTCCTCCACCGTACCTGGCTCAAGGGAGTCCGAGCCTTC
CAGGAATCCTCTGCCATGGGCAACATGACTTCGTCCGCCGTCAAGGGTCCGCTGCCACGCCACGCGGATGGACCT
AGCCCGGCCAAGCGCCGCCGCTTCACGTCGCCCGACTCGTTCGAGCTGGACCGTCTGCTCGCGGCCCCTCAGATG
GCCGAACTAGGCTCGGCCCTGCGCATTGAGGTGCTCAAGATCTTTCACAAGGACTCCAAAAAGGTCAGGTCGGTG
CAGACCTCGACCATCCCCCACGACTTCACCATCACCAAGGCCCGCTGCAGGATCACAATTTTCGACACCAGCTCC
GATCAGCCCCAGGTCCTTGACCGCCAGAGCAAGCTCTGCGACCTGGTAACTTTCAAAAATCCCGTGGGCCCTCAT
CGCGTCGCCCGCGTCGATCTGCCGCGCCCTTTCGTCGTCCCCCATGAGAGCATCCTCATCAACAGGCCGGAAGAT
GGCAGGCTTGATCTATCCGACTCGTACCAGCTCCTGGTCGAGCTGGAAGCCGCCAACGGGAGTCGCTGGCCTCCG
CTCGACACCAATGATTTCGGCCTCTCATCCGCAATGCCTTTTCCCCAGGCAGACTCGACCCAGCATTGGATCTTG
TCCAGCCGCTTCGACAGCGTCGTCGGCAGGCTAAAGAACTCGCTCGATCTGACGGCCAGGCTGTCCCCGCAACAG
CCACCCTTGGAGACTGATTATGTCATGGACGTTGACCTTCGATGGGCGGCAGGTCTTAAAGCGCTCAAACATGCC
GACAAGGACTCAAAACCGTGCATTACGGCTATCGATCCCGAGGTCCATTCCTGTCGTTTCGCAGATTTTCAACGC
CCCAACGGCCATGGCAATGGCAATGGGGAAACCTCTGTCGAACCAGATGACGAGTCTGTACTTGGTCATACGCCG
TCCCGCTCATTAAGGACGCGAGAAAAGGAAAAGGTGTACAATTTGAAAGTCTTGAGCGACCAGGCACACGGCAGA
GACCGGACAAAACGCGGCAGAAGCGGCAGCGTGACGACGACCGTCGAGGGTCGCGTCCAGTATCTCTTGCCGGCC
GATCAGCCCGTCTGCCTCGACTATTTCCGCTGCGTCAGCTGCGGTGCGTTCCACGAGTCCATGACCGAGCTGCAG
ACTCATCTCCGCACCGTCCACACAGCCTACGACTATGTTTTCGAGTCGACGAGTCAGGGGCCGCAGTTCCAAGTC
TCTGCTCGGCGTGAAACTTGCATCAAGCCGCACGGTTTCGGACGCCAAGTCCGGCCCTTTCACCTCTATACCCAC
GATCAGGTATGCGTTACGTCGCGTCCTGCCTTGGAAAATGAAGCCTACAGCAACCTGTCTCCGTCCAGGCCCGAG
CGACTGCAGTCTGGGTCGCCGGCCCTCAAGGGCTCCAAGCCCCTGATACAGCGTCGTCCGCGGAAACAAAAGGTT
GTCAAGGCCGTGGTGCCAGATATACCTCACCCGCTTTATCACCCCATTAGCAGGGCGCGCCTGAACCCCGGCGAT
GAGGTGCCAGAGACGGAGCCGGACAACACGTGGCTTATTCAGAGGCACCGAGACAGCATAGCCGAATTCTCTGAC
GTGACGCCGGCCGAGAAGGAGTACATTTGGGAATGGGACGGGTACATCCTCGGCAAGAACCTCACATCGCTCGCC
TACTTCCCGCGCGAGTGGCTCGGTTTCGTGCGAGAAAAGGCGACATGGCTCGTGTCGGAAAAGCGACGGATGCTG
GAGTTTGCGAAGCACTCGAGCGCCTTGCTGGCCCGCAACCTCTTGAACGACACGATGATGGAAGACGCCTTCGCC
ATGATTGATAAAGCGAGAGCCGCGCTGAAGCAGCAGGCCCGTCAAGACGAAGCAGAAGAGCAGCAGCAGCAGCCG
TCAGCCGGAGCCGCGAGCCCAAGACAGTCGCCCAAGGTTCGCAAGAGCGCCAGCGGCTGCGTTGTGTGTCAGTTG
CCGGTTCTCGGCCCGACGATGCTGATATGCTCCAACACGGTGGGTATCCCGTCTCGTCCCTTGCCTGGCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail