Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2100
Gene name
LocationContig_2:38473..40019
Strand+
Gene length (bp)1546
Transcript length (bp)1470
Coding sequence length (bp)1470
Protein length (aa) 490

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08572 PRP3 pre-mRNA processing factor 3 (PRP3) 2.4E-69 107 322
PF06544 DUF1115 Protein of unknown function (DUF1115) 7.6E-46 346 485

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q09856|PRP3_SCHPO U4/U5/U6 small nuclear ribonucleoprotein prp3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp3 PE=1 SV=1 44 489 2.0E-78
sp|Q5ZJ85|PRPF3_CHICK U4/U6 small nuclear ribonucleoprotein Prp3 OS=Gallus gallus GN=PRPF3 PE=2 SV=1 106 485 7.0E-64
sp|Q2KIA6|PRPF3_BOVIN U4/U6 small nuclear ribonucleoprotein Prp3 OS=Bos taurus GN=PRPF3 PE=2 SV=1 106 485 8.0E-64
sp|Q5R5F1|PRPF3_PONAB U4/U6 small nuclear ribonucleoprotein Prp3 OS=Pongo abelii GN=PRPF3 PE=2 SV=1 106 485 9.0E-64
sp|O43395|PRPF3_HUMAN U4/U6 small nuclear ribonucleoprotein Prp3 OS=Homo sapiens GN=PRPF3 PE=1 SV=2 106 485 9.0E-64
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q09856|PRP3_SCHPO U4/U5/U6 small nuclear ribonucleoprotein prp3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp3 PE=1 SV=1 44 489 2.0E-78
sp|Q5ZJ85|PRPF3_CHICK U4/U6 small nuclear ribonucleoprotein Prp3 OS=Gallus gallus GN=PRPF3 PE=2 SV=1 106 485 7.0E-64
sp|Q2KIA6|PRPF3_BOVIN U4/U6 small nuclear ribonucleoprotein Prp3 OS=Bos taurus GN=PRPF3 PE=2 SV=1 106 485 8.0E-64
sp|Q5R5F1|PRPF3_PONAB U4/U6 small nuclear ribonucleoprotein Prp3 OS=Pongo abelii GN=PRPF3 PE=2 SV=1 106 485 9.0E-64
sp|O43395|PRPF3_HUMAN U4/U6 small nuclear ribonucleoprotein Prp3 OS=Homo sapiens GN=PRPF3 PE=1 SV=2 106 485 9.0E-64
sp|Q922U1|PRPF3_MOUSE U4/U6 small nuclear ribonucleoprotein Prp3 OS=Mus musculus GN=Prpf3 PE=1 SV=1 106 485 2.0E-63
sp|Q03338|PRP3_YEAST U4/U6 small nuclear ribonucleoprotein PRP3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRP3 PE=1 SV=1 105 483 2.0E-25
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5368
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3325
Ophiocordyceps australis map64 (Brazil) OphauB2|2494
Ophiocordyceps camponoti-floridani Ophcf2|04279
Ophiocordyceps camponoti-rufipedis Ophun1|2100 (this protein)
Ophiocordyceps kimflemingae Ophio5|1131
Ophiocordyceps subramaniannii Hirsu2|5362

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2100
MDTRPAGLGPRVDATSRVQKSSTVADKKAALKARVAAAIGTSRSKGGLNVGLHPALEDLSSWKSQSKSGDNLKAP
NNPPPKSFSNQGSQNVHPKGNARLDIGNRGSNPYFDEVPPTQATGSRSREPKRLVFNQKGKYIQQAAALRRQADL
EAMKKRIAEQTRRAGIDDDLDVEKNFVPDPPPDIEWWDEGLLDGRNYDHIEDPTKLKLNTADSIVTEYIQHPVAL
KPPQDRHQTPAKPMFLTSKEQAKLRRQRRTAELKELQAKIRVGFIAAPPPKVKKANLMRVLGDVAVKDPTAVEAR
VNREIEERQQKHMQTNEERKLTKDQKHDKLAKNQLTDASKGIHIQAFKITTLANGQHRYKIGVNAEQLALTGICI
MNPKYNLVIVEGGAWSIDKFRKLMLQRIKWTENSPAPKSEGKRVSAHDWLRPESDGGELKDMSLNECKLIFSGEQ
KARAFRKWSSKVCETDVEARETLARVKMENFWSLAKNFC*
Coding >Ophun1|2100
ATGGACACGCGTCCCGCGGGCCTTGGCCCTCGGGTTGACGCCACCTCTCGAGTCCAGAAGTCTTCCACTGTCGCC
GACAAGAAAGCCGCCCTCAAGGCTCGCGTCGCCGCTGCCATAGGCACGAGCAGATCGAAGGGGGGCTTAAACGTT
GGGCTTCATCCAGCTCTTGAGGATCTCAGCTCCTGGAAGTCTCAGAGCAAATCCGGAGACAACCTCAAAGCTCCA
AACAACCCGCCGCCCAAGTCTTTCTCGAATCAAGGCTCGCAAAATGTCCACCCAAAGGGAAATGCTCGTCTGGAT
ATTGGCAACCGGGGTAGTAACCCATACTTTGACGAAGTTCCGCCGACACAGGCAACGGGATCGAGAAGTCGTGAG
CCCAAGAGACTGGTGTTCAACCAAAAGGGAAAATACATCCAGCAGGCCGCCGCTCTACGTCGACAAGCTGATCTC
GAGGCTATGAAGAAGCGGATAGCGGAGCAGACCAGGAGAGCAGGCATTGACGACGACCTCGATGTCGAGAAGAAC
TTTGTTCCTGATCCTCCACCTGATATTGAGTGGTGGGACGAGGGTTTACTGGATGGACGGAATTACGACCACATC
GAAGACCCGACAAAGTTGAAACTAAACACTGCGGACAGCATCGTGACCGAGTACATACAGCATCCAGTCGCGCTC
AAGCCACCGCAGGATCGTCATCAAACCCCAGCCAAGCCGATGTTCTTGACCTCCAAAGAACAGGCAAAACTTCGA
CGACAGAGAAGAACGGCCGAATTGAAGGAATTGCAGGCCAAAATCAGGGTTGGCTTCATTGCAGCACCTCCTCCG
AAAGTGAAGAAAGCGAACCTGATGCGCGTTCTTGGGGATGTTGCTGTCAAAGACCCCACCGCGGTGGAGGCTAGA
GTGAACCGCGAGATCGAAGAGCGACAACAGAAACACATGCAGACGAACGAGGAACGAAAATTGACCAAGGACCAG
AAACACGACAAGCTTGCCAAGAATCAACTTACAGACGCCAGCAAGGGCATACATATCCAAGCTTTCAAGATTACG
ACATTGGCCAACGGTCAGCACCGTTACAAGATTGGAGTCAATGCCGAGCAACTAGCGTTGACTGGAATCTGCATC
ATGAACCCGAAATATAATCTTGTCATCGTGGAAGGGGGGGCATGGAGCATCGACAAGTTCAGAAAGCTCATGCTT
CAACGGATCAAATGGACCGAAAACTCACCTGCCCCCAAGTCTGAGGGTAAACGGGTCTCGGCGCATGATTGGCTT
CGACCAGAGAGCGACGGCGGAGAGCTGAAAGATATGTCATTGAACGAGTGCAAGCTCATCTTTTCGGGCGAACAA
AAGGCGAGGGCATTCAGAAAATGGAGCAGCAAGGTTTGCGAGACCGACGTCGAGGCGCGGGAGACTTTGGCCCGC
GTCAAAATGGAGAATTTCTGGTCTTTGGCAAAGAACTTTTGTTGA
Transcript >Ophun1|2100
ATGGACACGCGTCCCGCGGGCCTTGGCCCTCGGGTTGACGCCACCTCTCGAGTCCAGAAGTCTTCCACTGTCGCC
GACAAGAAAGCCGCCCTCAAGGCTCGCGTCGCCGCTGCCATAGGCACGAGCAGATCGAAGGGGGGCTTAAACGTT
GGGCTTCATCCAGCTCTTGAGGATCTCAGCTCCTGGAAGTCTCAGAGCAAATCCGGAGACAACCTCAAAGCTCCA
AACAACCCGCCGCCCAAGTCTTTCTCGAATCAAGGCTCGCAAAATGTCCACCCAAAGGGAAATGCTCGTCTGGAT
ATTGGCAACCGGGGTAGTAACCCATACTTTGACGAAGTTCCGCCGACACAGGCAACGGGATCGAGAAGTCGTGAG
CCCAAGAGACTGGTGTTCAACCAAAAGGGAAAATACATCCAGCAGGCCGCCGCTCTACGTCGACAAGCTGATCTC
GAGGCTATGAAGAAGCGGATAGCGGAGCAGACCAGGAGAGCAGGCATTGACGACGACCTCGATGTCGAGAAGAAC
TTTGTTCCTGATCCTCCACCTGATATTGAGTGGTGGGACGAGGGTTTACTGGATGGACGGAATTACGACCACATC
GAAGACCCGACAAAGTTGAAACTAAACACTGCGGACAGCATCGTGACCGAGTACATACAGCATCCAGTCGCGCTC
AAGCCACCGCAGGATCGTCATCAAACCCCAGCCAAGCCGATGTTCTTGACCTCCAAAGAACAGGCAAAACTTCGA
CGACAGAGAAGAACGGCCGAATTGAAGGAATTGCAGGCCAAAATCAGGGTTGGCTTCATTGCAGCACCTCCTCCG
AAAGTGAAGAAAGCGAACCTGATGCGCGTTCTTGGGGATGTTGCTGTCAAAGACCCCACCGCGGTGGAGGCTAGA
GTGAACCGCGAGATCGAAGAGCGACAACAGAAACACATGCAGACGAACGAGGAACGAAAATTGACCAAGGACCAG
AAACACGACAAGCTTGCCAAGAATCAACTTACAGACGCCAGCAAGGGCATACATATCCAAGCTTTCAAGATTACG
ACATTGGCCAACGGTCAGCACCGTTACAAGATTGGAGTCAATGCCGAGCAACTAGCGTTGACTGGAATCTGCATC
ATGAACCCGAAATATAATCTTGTCATCGTGGAAGGGGGGGCATGGAGCATCGACAAGTTCAGAAAGCTCATGCTT
CAACGGATCAAATGGACCGAAAACTCACCTGCCCCCAAGTCTGAGGGTAAACGGGTCTCGGCGCATGATTGGCTT
CGACCAGAGAGCGACGGCGGAGAGCTGAAAGATATGTCATTGAACGAGTGCAAGCTCATCTTTTCGGGCGAACAA
AAGGCGAGGGCATTCAGAAAATGGAGCAGCAAGGTTTGCGAGACCGACGTCGAGGCGCGGGAGACTTTGGCCCGC
GTCAAAATGGAGAATTTCTGGTCTTTGGCAAAGAACTTTTGTTGA
Gene >Ophun1|2100
ATGGACACGCGTCCCGCGGGCCTTGGCCCTCGGGTTGACGCCACCTCTCGAGTCCAGAAGTCTTCCACTGTCGCC
GACAAGAAAGCCGCCCTCAAGGCTCGCGTCGCCGCTGCCATAGGCACGAGCAGATCGAAGGGGGGCTTAAACGTT
GGGCTTCATCCAGCTCTTGAGGATCTCAGCTCCTGGAAGTCTCAGAGCAAATCCGGAGACAACCTCAAAGCTCCA
AACAACCCGCCGCCCAAGTCTTTCTCGAATCAAGGCTCGCAAAATGTCCACCCAAAGGGAAATGCTCGTCTGGAT
ATTGGCAACCGGGGTAGTAACCCATACTTTGACGAAGTTCCGCCGACACAGGCAACGGGATCGAGAAGTCGTGAG
CCCAAGAGACTGGTGTTCAACCAAAAGGGAAAATACATCCAGCAGGCCGCCGCTCTACGTCGACAAGCTGATCTC
GAGGCTATGAAGAAGCGGATAGCGGAGCAGACCAGGAGAGCAGGCATTGACGACGACCTCGATGTCGAGAAGAAC
TTTGTTCCTGATCCTCCACCTGATATTGAGTGGTGGGACGAGGGTTTACTGGATGGACGGAATTACGACCACATC
GAAGACCCGACAAAGTTGAAACTAAACACTGCGGACAGCATCGTGACCGAGTACATACAGCATCCAGTCGCGCTC
AAGCCACCGCAGGATCGTCATCAAACCCCAGCCAAGCCGATGTTCTTGACCTCCAAAGAACAGGCAAAACTTCGA
CGACAGAGAAGAACGGCCGAATTGAAGGAATTGCAGGCCAAAATCAGGGTTGGCTTCATTGCAGCACCTCCTCCG
AAAGTGAAGAAAGCGAACCTGATGCGCGTTCTTGGGGATGGTAAGTCCTTCCCACCCTGACTTATGGTGGACGCA
GAAGAGGGGTGGGAAGATGTGAGGCGCTGACGCTGCTGCAGTTGCTGTCAAAGACCCCACCGCGGTGGAGGCTAG
AGTGAACCGCGAGATCGAAGAGCGACAACAGAAACACATGCAGACGAACGAGGAACGAAAATTGACCAAGGACCA
GAAACACGACAAGCTTGCCAAGAATCAACTTACAGACGCCAGCAAGGGCATACATATCCAAGCTTTCAAGATTAC
GACATTGGCCAACGGTCAGCACCGTTACAAGATTGGAGTCAATGCCGAGCAACTAGCGTTGACTGGAATCTGCAT
CATGAACCCGAAATATAATCTTGTCATCGTGGAAGGGGGGGCATGGAGCATCGACAAGTTCAGAAAGCTCATGCT
TCAACGGATCAAATGGACCGAAAACTCACCTGCCCCCAAGTCTGAGGGTAAACGGGTCTCGGCGCATGATTGGCT
TCGACCAGAGAGCGACGGCGGAGAGCTGAAAGATATGTCATTGAACGAGTGCAAGCTCATCTTTTCGGGCGAACA
AAAGGCGAGGGCATTCAGAAAATGGAGCAGCAAGGTTTGCGAGACCGACGTCGAGGCGCGGGAGACTTTGGCCCG
CGTCAAAATGGAGAATTTCTGGTCTTTGGCAAAGAACTTTTGTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail