Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2097
Gene name
LocationContig_2:31461..33400
Strand+
Gene length (bp)1939
Transcript length (bp)1752
Coding sequence length (bp)1752
Protein length (aa) 584

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q59VM4|RPN4_CANAL Transcriptional regulator RPN4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RPN4 PE=1 SV=1 480 567 9.0E-18
sp|Q9Y815|RSV2_SCHPO Zinc finger protein rsv2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rsv2 PE=3 SV=1 500 567 5.0E-17
sp|Q03465|RPN4_YEAST Protein RPN4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPN4 PE=1 SV=1 434 572 1.0E-11

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup6146
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3321
Ophiocordyceps australis map64 (Brazil) OphauB2|2490
Ophiocordyceps camponoti-rufipedis Ophun1|2097 (this protein)
Ophiocordyceps kimflemingae Ophio5|862
Ophiocordyceps subramaniannii Hirsu2|4709

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2097
MISSASRTHSSCNRLSHLLPQTDLCQQEQPHHRYEIAEVPDCSLSSAAAPLSTDPDLDDPDDNQEFCVVPGSLSR
TLMLADTCGSNLSIDPSRTPTRLEPASSITDSRNATSILVDDRVPPNPSLSLPRTTLSCFAQTTPTDTSSLRDGA
DNQQFTNSSQTAFDTAGDECAKTEMASSPSAIYNSFRRFGFDRTAQLDSDIATGSATQPRHHAAISSSADAQTGP
VTDDVNESQRINGGCRNVPKLDRTMTDIYSDELYSPNFAITSTSPLRGHTEVSPSNDLFSQRINAANSQHLNAAH
SPSSTTFRTQSPFRTCSPFVSSSPHATWPAINQSQRSSDDSKLKQAVTSLPQPEDCALVNIDNEPETPKTISPKD
AILEFSEAEADINFPLFPPDTATFTIQATPKDIIGQLTDDSFSPSNVARQLAGLSNLEFPTPQTTEGLIAASNCP
SSSGTGSGNHTPPRLSSSRSNSITSESNNSTTDAVKPPRCGITPGLLNTQAGPHRCDRINPSTGKSCNTVFSRPY
DLTRHEDTIHNARKQKVRCDLCAEEKTFSRADALTRHYRVCHPDVDLPGVKHKRRGGH*
Coding >Ophun1|2097
ATGATCTCTTCCGCTTCTCGGACTCACTCCTCCTGTAACCGTCTATCTCACCTTCTTCCGCAGACAGATCTTTGC
CAGCAAGAACAGCCCCACCACCGCTACGAAATCGCAGAAGTACCGGATTGTTCGCTTTCCAGCGCTGCCGCCCCC
CTGTCCACCGACCCGGACTTGGACGATCCTGACGATAACCAAGAATTCTGTGTCGTCCCGGGCAGTCTGTCGCGG
ACATTAATGTTAGCAGACACCTGCGGTTCAAATTTGTCAATCGATCCGAGCCGGACACCTACCCGCCTCGAGCCG
GCATCGTCGATAACCGATTCGCGGAACGCAACATCAATTCTCGTCGACGACCGAGTACCACCCAACCCTTCACTA
TCTCTACCCAGAACCACCTTATCCTGCTTCGCTCAGACGACACCGACTGATACCTCATCCCTCCGAGACGGCGCC
GATAATCAACAGTTCACGAACTCTTCACAGACTGCCTTTGACACAGCCGGCGACGAATGTGCCAAAACCGAAATG
GCCTCTTCCCCATCAGCGATATACAACTCCTTCAGGAGATTTGGTTTCGATCGCACTGCACAGCTTGATTCGGAC
ATAGCGACTGGCTCCGCAACGCAGCCTCGTCATCACGCTGCGATAAGCAGTTCCGCAGACGCGCAAACGGGCCCG
GTGACCGATGACGTCAACGAGTCCCAGAGAATAAATGGTGGATGTCGCAATGTTCCCAAATTGGATCGGACTATG
ACAGACATCTACAGCGACGAACTTTACAGCCCGAATTTCGCCATCACATCAACATCACCCTTGCGCGGCCACACA
GAGGTATCGCCTAGTAACGACCTTTTCAGTCAACGCATCAATGCCGCCAATAGCCAACATTTAAATGCCGCGCAT
TCGCCTTCCTCTACAACGTTCAGAACCCAATCACCGTTTCGAACGTGCTCACCTTTTGTGTCTTCCTCACCTCAC
GCAACATGGCCTGCGATCAATCAATCACAGCGATCATCTGACGATAGCAAGTTGAAGCAAGCTGTGACGTCATTG
CCGCAGCCCGAAGATTGCGCCCTGGTCAATATCGACAACGAGCCGGAGACACCCAAAACGATTTCCCCCAAGGAT
GCTATTCTGGAATTTAGCGAGGCCGAGGCAGATATCAACTTCCCGTTATTTCCTCCAGATACAGCTACCTTCACG
ATTCAGGCGACCCCAAAGGACATTATAGGTCAATTAACCGACGATTCGTTCAGCCCATCCAATGTCGCCCGACAG
CTTGCCGGCTTGAGCAACTTGGAATTTCCTACGCCTCAAACCACCGAGGGCTTGATCGCAGCGTCGAATTGTCCA
TCGTCTTCAGGGACAGGCTCGGGTAACCACACACCGCCGCGACTCAGCTCTTCACGATCGAACTCGATCACTTCG
GAGAGCAACAACTCAACCACGGACGCGGTCAAGCCACCGCGATGTGGCATTACGCCAGGTCTCTTGAATACGCAG
GCCGGGCCACACCGCTGCGACCGCATTAACCCGAGCACGGGAAAGTCATGCAATACGGTCTTCTCGCGGCCTTAT
GACTTGACCAGACACGAGGATACGATCCACAACGCACGCAAACAAAAGGTTCGATGTGATCTGTGTGCAGAGGAG
AAAACATTCAGCCGCGCCGACGCTTTGACGAGGCATTATCGCGTGTGCCATCCCGACGTTGACCTGCCAGGCGTG
AAACACAAACGTCGGGGAGGACATTAG
Transcript >Ophun1|2097
ATGATCTCTTCCGCTTCTCGGACTCACTCCTCCTGTAACCGTCTATCTCACCTTCTTCCGCAGACAGATCTTTGC
CAGCAAGAACAGCCCCACCACCGCTACGAAATCGCAGAAGTACCGGATTGTTCGCTTTCCAGCGCTGCCGCCCCC
CTGTCCACCGACCCGGACTTGGACGATCCTGACGATAACCAAGAATTCTGTGTCGTCCCGGGCAGTCTGTCGCGG
ACATTAATGTTAGCAGACACCTGCGGTTCAAATTTGTCAATCGATCCGAGCCGGACACCTACCCGCCTCGAGCCG
GCATCGTCGATAACCGATTCGCGGAACGCAACATCAATTCTCGTCGACGACCGAGTACCACCCAACCCTTCACTA
TCTCTACCCAGAACCACCTTATCCTGCTTCGCTCAGACGACACCGACTGATACCTCATCCCTCCGAGACGGCGCC
GATAATCAACAGTTCACGAACTCTTCACAGACTGCCTTTGACACAGCCGGCGACGAATGTGCCAAAACCGAAATG
GCCTCTTCCCCATCAGCGATATACAACTCCTTCAGGAGATTTGGTTTCGATCGCACTGCACAGCTTGATTCGGAC
ATAGCGACTGGCTCCGCAACGCAGCCTCGTCATCACGCTGCGATAAGCAGTTCCGCAGACGCGCAAACGGGCCCG
GTGACCGATGACGTCAACGAGTCCCAGAGAATAAATGGTGGATGTCGCAATGTTCCCAAATTGGATCGGACTATG
ACAGACATCTACAGCGACGAACTTTACAGCCCGAATTTCGCCATCACATCAACATCACCCTTGCGCGGCCACACA
GAGGTATCGCCTAGTAACGACCTTTTCAGTCAACGCATCAATGCCGCCAATAGCCAACATTTAAATGCCGCGCAT
TCGCCTTCCTCTACAACGTTCAGAACCCAATCACCGTTTCGAACGTGCTCACCTTTTGTGTCTTCCTCACCTCAC
GCAACATGGCCTGCGATCAATCAATCACAGCGATCATCTGACGATAGCAAGTTGAAGCAAGCTGTGACGTCATTG
CCGCAGCCCGAAGATTGCGCCCTGGTCAATATCGACAACGAGCCGGAGACACCCAAAACGATTTCCCCCAAGGAT
GCTATTCTGGAATTTAGCGAGGCCGAGGCAGATATCAACTTCCCGTTATTTCCTCCAGATACAGCTACCTTCACG
ATTCAGGCGACCCCAAAGGACATTATAGGTCAATTAACCGACGATTCGTTCAGCCCATCCAATGTCGCCCGACAG
CTTGCCGGCTTGAGCAACTTGGAATTTCCTACGCCTCAAACCACCGAGGGCTTGATCGCAGCGTCGAATTGTCCA
TCGTCTTCAGGGACAGGCTCGGGTAACCACACACCGCCGCGACTCAGCTCTTCACGATCGAACTCGATCACTTCG
GAGAGCAACAACTCAACCACGGACGCGGTCAAGCCACCGCGATGTGGCATTACGCCAGGTCTCTTGAATACGCAG
GCCGGGCCACACCGCTGCGACCGCATTAACCCGAGCACGGGAAAGTCATGCAATACGGTCTTCTCGCGGCCTTAT
GACTTGACCAGACACGAGGATACGATCCACAACGCACGCAAACAAAAGGTTCGATGTGATCTGTGTGCAGAGGAG
AAAACATTCAGCCGCGCCGACGCTTTGACGAGGCATTATCGCGTGTGCCATCCCGACGTTGACCTGCCAGGCGTG
AAACACAAACGTCGGGGAGGACATTAG
Gene >Ophun1|2097
ATGATCTCTTCCGCTTCTCGGACTCACTCCTCCTGTAACCGTCTATCTCACCTTCTTCCGCAGACAGATCTTTGC
CAGCAAGAACAGCCCCACCACCGCTACGAAATCGCAGAAGTACCGGATTGTTCGCTTTCCAGCGCTGCCGCCCCC
CTGTCCACCGACCCGGACTTGGACGATCCTGACGATAACCAAGAATTCTGTGTCGTCCCGGGCAGTCTGTCGCGG
ACATTAATGTTAGCAGACACCTGCGGTTCAAATTTGTCAATCGATCCGAGCCGGACACCTACCCGCCTCGAGCCG
GCATCGTCGATAACCGATTCGCGGAACGCAACATCAATTCTCGTCGACGACCGAGTACCACCCAACCCTTCACTA
TCTCTACCCAGAACCACCTTATCCTGCTTCGCTCAGACGACACCGACTGATACCTCATCCCTCCGAGACGGCGCC
GATAATCAACAGTTCACGAACTCTTCACAGACTGCCTTTGACACAGCCGGCGACGAATGTGCCAAAACCGAAATG
GCCTCTTCCCCATCAGCGATATACAACTCCTTCAGGAGATTTGGTTTCGATCGCACTGCACAGCTTGATTCGGAC
ATAGCGACTGGCTCCGCAACGCAGCCTCGTCATCACGCTGCGATAAGCAGTTCCGCAGACGCGCAAACGGGCCCG
GTGACCGATGACGTCAACGAGTCCCAGAGAATAAATGGTGGTAAGCGCGCAACGGACTTCACATTTCTTCCGCTC
TCGCCTAATAAGTTTTTTAGGATGTCGCAATGTTCCCAAATTGGATCGGACTATGACAGACATCTACAGCGACGA
ACTTTACAGCCCGAATTTCGCCATCACATCAACATCACCCTTGCGCGGCCACACAGAGGTATCGCCTAGTAACGA
CCTTTTCAGTCAACGCATCAATGCCGCCAATAGCCAACATTTAAATGCCGCGCATTCGCCTTCCTCTACAACGTT
CAGAACCCAATCACCGTTTCGAACGTGCTCACCTTTTGTGTCTTCCTCACCTCACGCAACATGGCCTGCGATCAA
TCAATCACAGCGATCATCTGACGATAGCAAGTTGAAGCAAGCTGTGACGTCATTGCCGCAGCCCGAAGATTGCGC
CCTGGTCAATATCGACAACGAGCCGGAGACACCCAAAACGATTTCCCCCAAGGATGCTATTCTGGAATTTAGCGA
GGCCGAGGCAGATATCAACTTCCCGTTATTTCCTCCAGATACAGCTACCTTCACGATTCAGGCGACCCCAAAGGA
CATTATAGGTCAATTAACCGACGATTCGTTCAGCCCATCCAATGTCGCCCGACAGCTTGCCGGCTTGAGCAACTT
GGAATTTCCTACGCCTCAAACCACCGAGGGCTTGATCGCAGCGTCGAATTGTCCATCGTCTTCAGGGACAGGCTC
GGGTAACCACACACCGCCGCGACTCAGCTCTTCACGATCGAACTCGATCACTTCGGAGAGCAACAACTCAACCAC
GGACGCGGTCAAGCCACCGCGATGTGGTGCGGATGCTGGGACTTACACCTGCACTTATCATGGATGCACACAACG
ATTTGAAACACCTTTATTGCTGCAAAAACACAAACGAGAAGGACACCGACAGTCGCAAGGATCATGTTCCTCGAT
CGATACAGGCATTACGCCAGGTCTCTTGAATACGCAGGCCGGGCCACACCGCTGCGACCGCATTAACCCGAGCAC
GGGAAAGTCATGCAATACGGTCTTCTCGCGGCCTTATGACTTGACCAGACACGAGGATACGATCCACAACGCACG
CAAACAAAAGGTTCGATGTGATCTGTGTGCAGAGGAGAAAACATTCAGCCGCGCCGACGCTTTGACGAGGCATTA
TCGCGTGTGCCATCCCGACGTTGACCTGCCAGGCGTGAAACACAAACGTCGGGGAGGACATTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail