Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2094
Gene name
LocationContig_2:17672..21776
Strand+
Gene length (bp)4104
Transcript length (bp)4104
Coding sequence length (bp)4104
Protein length (aa) 1368

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04998 RNA_pol_Rpb1_5 RNA polymerase Rpb1, domain 5 2.8E-84 628 1304
PF00623 RNA_pol_Rpb1_2 RNA polymerase Rpb1, domain 2 9.7E-67 112 290
PF04983 RNA_pol_Rpb1_3 RNA polymerase Rpb1, domain 3 3.4E-33 295 472
PF05000 RNA_pol_Rpb1_4 RNA polymerase Rpb1, domain 4 3.7E-17 550 621
PF04997 RNA_pol_Rpb1_1 RNA polymerase Rpb1, domain 1 2.4E-11 4 110

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P10964|RPA1_YEAST DNA-directed RNA polymerase I subunit RPA190 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPA190 PE=1 SV=2 2 1359 0.0E+00
sp|P15398|RPA1_SCHPO DNA-directed RNA polymerase I subunit rpa1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpa1 PE=1 SV=2 1 1356 0.0E+00
sp|Q86H36|RPA1_DICDI DNA-directed RNA polymerase I subunit rpa1 OS=Dictyostelium discoideum GN=polr1a PE=3 SV=1 2 999 0.0E+00
sp|Q9SVY0|NRPA1_ARATH DNA-directed RNA polymerase I subunit 1 OS=Arabidopsis thaliana GN=NRPA1 PE=3 SV=1 1 1360 0.0E+00
sp|O35134|RPA1_MOUSE DNA-directed RNA polymerase I subunit RPA1 OS=Mus musculus GN=Polr1a PE=1 SV=2 1 976 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P10964|RPA1_YEAST DNA-directed RNA polymerase I subunit RPA190 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPA190 PE=1 SV=2 2 1359 0.0E+00
sp|P15398|RPA1_SCHPO DNA-directed RNA polymerase I subunit rpa1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpa1 PE=1 SV=2 1 1356 0.0E+00
sp|Q86H36|RPA1_DICDI DNA-directed RNA polymerase I subunit rpa1 OS=Dictyostelium discoideum GN=polr1a PE=3 SV=1 2 999 0.0E+00
sp|Q9SVY0|NRPA1_ARATH DNA-directed RNA polymerase I subunit 1 OS=Arabidopsis thaliana GN=NRPA1 PE=3 SV=1 1 1360 0.0E+00
sp|O35134|RPA1_MOUSE DNA-directed RNA polymerase I subunit RPA1 OS=Mus musculus GN=Polr1a PE=1 SV=2 1 976 0.0E+00
sp|O54889|RPA1_RAT DNA-directed RNA polymerase I subunit RPA1 OS=Rattus norvegicus GN=Polr1a PE=1 SV=1 1 976 0.0E+00
sp|O95602|RPA1_HUMAN DNA-directed RNA polymerase I subunit RPA1 OS=Homo sapiens GN=POLR1A PE=1 SV=2 1 989 0.0E+00
sp|P91875|RPA1_DROME DNA-directed RNA polymerase I subunit RPA1 OS=Drosophila melanogaster GN=RpI1 PE=1 SV=2 1 982 0.0E+00
sp|P16355|RPA1_TRYBB DNA-directed RNA polymerase I subunit RPA1 OS=Trypanosoma brucei brucei GN=TRP11 PE=1 SV=1 1 876 2.0E-151
sp|P36594|RPB1_SCHPO DNA-directed RNA polymerase II subunit rpb1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpb1 PE=1 SV=1 68 887 3.0E-132
sp|Q5ZL98|RPC1_CHICK DNA-directed RNA polymerase III subunit RPC1 OS=Gallus gallus GN=POLR3A PE=2 SV=1 54 885 1.0E-126
sp|O14802|RPC1_HUMAN DNA-directed RNA polymerase III subunit RPC1 OS=Homo sapiens GN=POLR3A PE=1 SV=2 54 885 2.0E-125
sp|O94666|RPC1_SCHPO DNA-directed RNA polymerase III subunit rpc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpc1 PE=2 SV=1 55 885 2.0E-125
sp|A4IF62|RPC1_BOVIN DNA-directed RNA polymerase III subunit RPC1 OS=Bos taurus GN=POLR3A PE=2 SV=1 54 885 3.0E-125
sp|P18616|NRPB1_ARATH DNA-directed RNA polymerase II subunit 1 OS=Arabidopsis thaliana GN=NRPB1 PE=1 SV=3 68 896 8.0E-123
sp|F4JXF9|NRPC1_ARATH DNA-directed RNA polymerase III subunit 1 OS=Arabidopsis thaliana GN=NRPC1 PE=2 SV=1 2 885 3.0E-120
sp|Q6BI69|RPC1_DEBHA DNA-directed RNA polymerase III subunit RPC1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=RPC1 PE=3 SV=2 1 882 1.0E-119
sp|P04051|RPC1_YEAST DNA-directed RNA polymerase III subunit RPC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPO31 PE=1 SV=1 10 882 2.0E-117
sp|P17546|RPB1A_TRYBB DNA-directed RNA polymerase II subunit RPB1-A OS=Trypanosoma brucei brucei GN=TRP4.8 PE=1 SV=1 2 888 3.0E-115
sp|P17545|RPB1B_TRYBB DNA-directed RNA polymerase II subunit RPB1-B OS=Trypanosoma brucei brucei GN=TRP5.9 PE=1 SV=1 2 888 3.0E-115
sp|Q86AQ5|RPC1_DICDI DNA-directed RNA polymerase III subunit rpc1 OS=Dictyostelium discoideum GN=polr3a PE=3 SV=1 2 695 2.0E-113
sp|P08775|RPB1_MOUSE DNA-directed RNA polymerase II subunit RPB1 OS=Mus musculus GN=Polr2a PE=1 SV=3 2 887 1.0E-109
sp|P24928|RPB1_HUMAN DNA-directed RNA polymerase II subunit RPB1 OS=Homo sapiens GN=POLR2A PE=1 SV=2 2 887 1.0E-109
sp|P08968|RPC1_TRYBB DNA-directed RNA polymerase III subunit RPC1 OS=Trypanosoma brucei brucei PE=3 SV=1 2 695 3.0E-108
sp|Q8SSC4|RPB1_ENCCU DNA-directed RNA polymerase II subunit RPB1 OS=Encephalitozoon cuniculi (strain GB-M1) GN=RPB1 PE=3 SV=1 2 722 2.0E-105
sp|P04052|RPB1_DROME DNA-directed RNA polymerase II subunit RPB1 OS=Drosophila melanogaster GN=RpII215 PE=3 SV=4 2 694 3.0E-105
sp|P31813|RPOA1_THECE DNA-directed RNA polymerase subunit A' OS=Thermococcus celer GN=rpoA1 PE=3 SV=1 2 699 8.0E-105
sp|P04050|RPB1_YEAST DNA-directed RNA polymerase II subunit RPB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPO21 PE=1 SV=2 47 695 2.0E-104
sp|Q75A34|RPB1_ASHGO DNA-directed RNA polymerase II subunit RPB1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RPB1 PE=3 SV=2 66 695 6.0E-103
sp|P35074|RPB1_CAEBR DNA-directed RNA polymerase II subunit RPB1 OS=Caenorhabditis briggsae GN=rpb-1 PE=3 SV=2 2 887 2.0E-100
sp|Q980R2|RPOA1_SULSO DNA-directed RNA polymerase subunit A' OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=rpoA1 PE=1 SV=1 2 694 2.0E-100
sp|P11512|RPOA1_SULAC DNA-directed RNA polymerase subunit A' OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=rpoA1 PE=3 SV=2 2 694 3.0E-100
sp|P35084|RPB1_DICDI DNA-directed RNA polymerase II subunit rpb1 OS=Dictyostelium discoideum GN=polr2a PE=2 SV=2 48 695 3.0E-100
sp|P16356|RPB1_CAEEL DNA-directed RNA polymerase II subunit RPB1 OS=Caenorhabditis elegans GN=ama-1 PE=1 SV=3 2 695 6.0E-100
sp|P41556|RPOA1_METVS DNA-directed RNA polymerase subunit A' OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=rpoA1 PE=3 SV=1 2 701 4.0E-92
sp|O27125|RPOA1_METTH DNA-directed RNA polymerase subunit A' OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=rpoA1 PE=3 SV=1 2 701 3.0E-91
sp|Q03585|RPOA1_THEAC DNA-directed RNA polymerase subunit A' OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=rpoA1 PE=3 SV=1 2 699 6.0E-91
sp|P0CX02|RPOA1_HALSA DNA-directed RNA polymerase subunit A' OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=rpoA1 PE=3 SV=1 2 693 7.0E-91
sp|B0R8D4|RPOA1_HALS3 DNA-directed RNA polymerase subunit A' OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=rpoA1 PE=1 SV=1 2 693 7.0E-91
sp|P09846|RPOA1_METTW DNA-directed RNA polymerase subunit A' OS=Methanothermobacter thermautotrophicus (strain Winter) GN=rpoA1 PE=3 SV=2 2 701 3.0E-77
sp|P27625|RPC1_PLAFA DNA-directed RNA polymerase III subunit RPC1 OS=Plasmodium falciparum PE=3 SV=1 216 695 4.0E-74
sp|Q7T6X5|RPO1_MIMIV DNA-directed RNA polymerase subunit 1 OS=Acanthamoeba polyphaga mimivirus GN=RPO1 PE=1 SV=2 9 695 1.0E-70
sp|P25202|RPC1_GIAIN DNA-directed RNA polymerase III subunit RPC1 OS=Giardia intestinalis GN=RPOA3 PE=3 SV=1 183 886 5.0E-70
sp|Q196X0|RPB1_IIV3 Probable DNA-directed RNA polymerase II subunit RPB1 homolog OS=Invertebrate iridescent virus 3 GN=IIV3-090L PE=3 SV=1 94 871 2.0E-58
sp|P0C987|RPB1_ASFP4 Probable DNA-directed RNA polymerase subunit 1 homolog OS=African swine fever virus (isolate Tick/South Africa/Pretoriuskop Pr4/1996) GN=Pret-111 PE=3 SV=1 2 695 5.0E-58
sp|P0C988|RPB1_ASFWA Probable DNA-directed RNA polymerase subunit 1 homolog OS=African swine fever virus (isolate Warthog/Namibia/Wart80/1980) GN=War-109 PE=3 SV=1 2 695 5.0E-58
sp|P42486|RPB1_ASFB7 Probable DNA-directed RNA polymerase subunit 1 homolog OS=African swine fever virus (strain Badajoz 1971 Vero-adapted) GN=Ba71V-99 PE=3 SV=1 2 695 7.0E-58
sp|Q65215|RPB1_ASFM2 Probable DNA-directed RNA polymerase subunit 1 homolog OS=African swine fever virus (isolate Tick/Malawi/Lil 20-1/1983) GN=Mal-107 PE=3 SV=2 2 695 9.0E-58
sp|P0C989|RPB1_ASFK5 Probable DNA-directed RNA polymerase subunit 1 homolog OS=African swine fever virus (isolate Pig/Kenya/KEN-50/1950) GN=Ken-111 PE=3 SV=1 2 695 1.0E-57
sp|P28363|RPA1_EUPOC DNA-directed RNA polymerase I subunit RPA1 (Fragment) OS=Euplotes octocarinatus GN=RPA1 PE=3 SV=1 1 272 2.0E-57
sp|Q6GZW7|RPB1_FRG3G Putative DNA-directed RNA polymerase 008R OS=Frog virus 3 (isolate Goorha) GN=FV3-008R PE=3 SV=1 2 855 2.0E-57
sp|Q58445|RPOA1_METJA DNA-directed RNA polymerase subunit A' OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=rpoA1 PE=3 SV=2 258 695 7.0E-55
sp|O55766|RPB1_IIV6 Probable DNA-directed RNA polymerase II subunit RPB1 homolog OS=Invertebrate iridescent virus 6 GN=IIV6-176R PE=3 SV=1 216 698 1.0E-53
sp|P14248|RPB1_PLAFD DNA-directed RNA polymerase II subunit RPB1 OS=Plasmodium falciparum (isolate CDC / Honduras) GN=RPII PE=3 SV=1 2 375 2.0E-50
sp|A5DCV3|RPB1_PICGU DNA-directed RNA polymerase II subunit RPB1 (Fragments) OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=RPB1 PE=3 SV=2 68 336 5.0E-45
sp|Q3A9Q8|RPOC_CARHZ DNA-directed RNA polymerase subunit beta' OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=rpoC PE=3 SV=1 2 872 3.0E-42
sp|Q250N9|RPOC_DESHY DNA-directed RNA polymerase subunit beta' OS=Desulfitobacterium hafniense (strain Y51) GN=rpoC PE=3 SV=1 2 872 6.0E-42
sp|Q1WVA4|RPOC_LACS1 DNA-directed RNA polymerase subunit beta' OS=Lactobacillus salivarius (strain UCC118) GN=rpoC PE=3 SV=1 1 872 7.0E-42
sp|Q0AUH3|RPOC_SYNWW DNA-directed RNA polymerase subunit beta' OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=rpoC PE=3 SV=1 1 872 8.0E-42
sp|B0TC49|RPOC_HELMI DNA-directed RNA polymerase subunit beta' OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=rpoC PE=3 SV=1 2 872 1.0E-41
sp|C5CC70|RPOC_MICLC DNA-directed RNA polymerase subunit beta' OS=Micrococcus luteus (strain ATCC 4698 / DSM 20030 / JCM 1464 / NBRC 3333 / NCIMB 9278 / NCTC 2665 / VKM Ac-2230) GN=rpoC PE=3 SV=1 1 892 2.0E-41
sp|P14248|RPB1_PLAFD DNA-directed RNA polymerase II subunit RPB1 OS=Plasmodium falciparum (isolate CDC / Honduras) GN=RPII PE=3 SV=1 405 694 8.0E-41
sp|Q9X6Y2|RPOC_AQUPY DNA-directed RNA polymerase subunit beta' OS=Aquifex pyrophilus GN=rpoC PE=3 SV=1 2 855 1.0E-40
sp|A4QBG3|RPOC_CORGB DNA-directed RNA polymerase subunit beta' OS=Corynebacterium glutamicum (strain R) GN=rpoC PE=3 SV=1 2 872 4.0E-40
sp|Q73SE3|RPOC_MYCPA DNA-directed RNA polymerase subunit beta' OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=rpoC PE=3 SV=1 1 872 5.0E-40
sp|Q8NT25|RPOC_CORGL DNA-directed RNA polymerase subunit beta' OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=rpoC PE=3 SV=1 2 872 7.0E-40
sp|A4T1P3|RPOC_MYCGI DNA-directed RNA polymerase subunit beta' OS=Mycobacterium gilvum (strain PYR-GCK) GN=rpoC PE=3 SV=1 1 872 9.0E-40
sp|Q82Z41|RPOC_ENTFA DNA-directed RNA polymerase subunit beta' OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=rpoC PE=3 SV=1 8 872 1.0E-39
sp|Q86H36|RPA1_DICDI DNA-directed RNA polymerase I subunit rpa1 OS=Dictyostelium discoideum GN=polr1a PE=3 SV=1 1157 1355 2.0E-39
sp|P96177|RPOC_WEIHE DNA-directed RNA polymerase subunit beta' (Fragment) OS=Weissella hellenica GN=rpoC PE=3 SV=1 8 872 2.0E-39
sp|Q1BDE9|RPOC_MYCSS DNA-directed RNA polymerase subunit beta' OS=Mycobacterium sp. (strain MCS) GN=rpoC PE=3 SV=1 1 872 3.0E-39
sp|A1UBJ4|RPOC_MYCSK DNA-directed RNA polymerase subunit beta' OS=Mycobacterium sp. (strain KMS) GN=rpoC PE=3 SV=1 1 872 3.0E-39
sp|A3PV79|RPOC_MYCSJ DNA-directed RNA polymerase subunit beta' OS=Mycobacterium sp. (strain JLS) GN=rpoC PE=3 SV=1 1 872 3.0E-39
sp|A0QL48|RPOC_MYCA1 DNA-directed RNA polymerase subunit beta' OS=Mycobacterium avium (strain 104) GN=rpoC PE=3 SV=1 1 872 4.0E-39
sp|O67763|RPOC_AQUAE DNA-directed RNA polymerase subunit beta' OS=Aquifex aeolicus (strain VF5) GN=rpoC PE=3 SV=1 2 855 4.0E-39
sp|B2UYA4|RPOC_CLOBA DNA-directed RNA polymerase subunit beta' OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=rpoC PE=3 SV=1 2 872 6.0E-39
sp|Q5YPE1|RPOC_NOCFA DNA-directed RNA polymerase subunit beta' OS=Nocardia farcinica (strain IFM 10152) GN=rpoC PE=3 SV=1 1 872 8.0E-39
sp|A6LPQ5|RPOC_CLOB8 DNA-directed RNA polymerase subunit beta' OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=rpoC PE=3 SV=1 2 872 9.0E-39
sp|B5YFV7|RPOC_THEYD DNA-directed RNA polymerase subunit beta' OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=rpoC PE=3 SV=1 2 861 1.0E-38
sp|A5D5I3|RPOC_PELTS DNA-directed RNA polymerase subunit beta' OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=rpoC PE=3 SV=1 2 872 1.0E-38
sp|A1T4J3|RPOC_MYCVP DNA-directed RNA polymerase subunit beta' OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=rpoC PE=3 SV=1 1 872 1.0E-38
sp|B8G4U8|RPOC_CHLAD DNA-directed RNA polymerase subunit beta' OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=rpoC PE=3 SV=1 2 872 2.0E-38
sp|C3PKN2|RPOC_CORA7 DNA-directed RNA polymerase subunit beta' OS=Corynebacterium aurimucosum (strain ATCC 700975 / DSM 44827 / CN-1) GN=rpoC PE=3 SV=1 2 882 2.0E-38
sp|A0PM25|RPOC_MYCUA DNA-directed RNA polymerase subunit beta' OS=Mycobacterium ulcerans (strain Agy99) GN=rpoC PE=3 SV=1 1 872 2.0E-38
sp|A9WSX9|RPOC_RENSM DNA-directed RNA polymerase subunit beta' OS=Renibacterium salmoninarum (strain ATCC 33209 / DSM 20767 / JCM 11484 / NBRC 15589 / NCIMB 2235) GN=rpoC PE=3 SV=1 1 891 2.0E-38
sp|P15349|RPOA1_HALMO DNA-directed RNA polymerase subunit A' (Fragment) OS=Halococcus morrhuae GN=rpoA1 PE=3 SV=1 407 692 2.0E-38
sp|P91875|RPA1_DROME DNA-directed RNA polymerase I subunit RPA1 OS=Drosophila melanogaster GN=RpI1 PE=1 SV=2 1149 1358 3.0E-38
sp|P96178|RPOC_WEIPA DNA-directed RNA polymerase subunit beta' (Fragment) OS=Weissella paramesenteroides GN=rpoC PE=3 SV=1 8 872 3.0E-38
sp|P28364|RPB1_EUPOC DNA-directed RNA polymerase II subunit RPB1 (Fragment) OS=Euplotes octocarinatus GN=RPB1 PE=3 SV=1 2 269 3.0E-38
sp|B9LL90|RPOC_CHLSY DNA-directed RNA polymerase subunit beta' OS=Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl) GN=rpoC PE=3 SV=1 2 925 3.0E-38
sp|B2HSJ4|RPOC_MYCMM DNA-directed RNA polymerase subunit beta' OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=rpoC PE=3 SV=1 1 872 4.0E-38
sp|A5GAY2|RPOC_GEOUR DNA-directed RNA polymerase subunit beta' OS=Geobacter uraniireducens (strain Rf4) GN=rpoC PE=3 SV=1 2 859 4.0E-38
sp|A5I7L3|RPOC_CLOBH DNA-directed RNA polymerase subunit beta' OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=rpoC PE=3 SV=1 2 872 4.0E-38
sp|A7FZ76|RPOC_CLOB1 DNA-directed RNA polymerase subunit beta' OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=rpoC PE=3 SV=1 2 872 4.0E-38
sp|B5EFP4|RPOC_GEOBB DNA-directed RNA polymerase subunit beta' OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=rpoC PE=3 SV=1 2 859 7.0E-38
sp|A4J104|RPOC_DESRM DNA-directed RNA polymerase subunit beta' OS=Desulfotomaculum reducens (strain MI-1) GN=rpoC PE=3 SV=1 2 872 8.0E-38
sp|A7Z0N0|RPOC_BACMF DNA-directed RNA polymerase subunit beta' OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=rpoC PE=3 SV=1 2 872 1.0E-37
sp|B9M6V1|RPOC_GEODF DNA-directed RNA polymerase subunit beta' OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=rpoC PE=3 SV=1 2 859 2.0E-37
sp|C1AYV8|RPOC_RHOOB DNA-directed RNA polymerase subunit beta' OS=Rhodococcus opacus (strain B4) GN=rpoC PE=3 SV=1 2 872 2.0E-37
sp|Q0SFB4|RPOC_RHOJR DNA-directed RNA polymerase subunit beta' OS=Rhodococcus jostii (strain RHA1) GN=rpoC PE=3 SV=1 2 872 2.0E-37
sp|Q3A6Q3|RPOC_PELCD DNA-directed RNA polymerase subunit beta' OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=rpoC PE=3 SV=1 2 859 2.0E-37
sp|P9WGY6|RPOC_MYCTO DNA-directed RNA polymerase subunit beta' OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=rpoC PE=3 SV=1 1 872 2.0E-37
sp|Q8FS96|RPOC_COREF DNA-directed RNA polymerase subunit beta' OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=rpoC PE=3 SV=1 2 872 3.0E-37
sp|A1KGE8|RPOC_MYCBP DNA-directed RNA polymerase subunit beta' OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=rpoC PE=3 SV=1 1 872 3.0E-37
sp|P9WGY7|RPOC_MYCTU DNA-directed RNA polymerase subunit beta' OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=rpoC PE=1 SV=1 1 872 3.0E-37
sp|A5U053|RPOC_MYCTA DNA-directed RNA polymerase subunit beta' OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=rpoC PE=3 SV=1 1 872 3.0E-37
sp|P0A675|RPOC_MYCBO DNA-directed RNA polymerase subunit beta' OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=rpoC PE=3 SV=1 1 872 3.0E-37
sp|C1AL01|RPOC_MYCBT DNA-directed RNA polymerase subunit beta' OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=rpoC PE=3 SV=1 1 872 3.0E-37
sp|C0ZVQ7|RPOC_RHOE4 DNA-directed RNA polymerase subunit beta' OS=Rhodococcus erythropolis (strain PR4 / NBRC 100887) GN=rpoC PE=3 SV=1 2 872 3.0E-37
sp|A9WH11|RPOC_CHLAA DNA-directed RNA polymerase subunit beta' OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=rpoC PE=3 SV=1 2 925 3.0E-37
sp|B3E7S9|RPOC_GEOLS DNA-directed RNA polymerase subunit beta' OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=rpoC PE=3 SV=1 2 859 4.0E-37
sp|B1I1M9|RPOC_DESAP DNA-directed RNA polymerase subunit beta' OS=Desulforudis audaxviator (strain MP104C) GN=rpoC PE=3 SV=1 2 872 6.0E-37
sp|Q18CF3|RPOC_PEPD6 DNA-directed RNA polymerase subunit beta' OS=Peptoclostridium difficile (strain 630) GN=rpoC PE=3 SV=1 1 872 1.0E-36
sp|Q1IHH5|RPOC_KORVE DNA-directed RNA polymerase subunit beta' OS=Koribacter versatilis (strain Ellin345) GN=rpoC PE=3 SV=2 2 859 2.0E-36
sp|C6E4R3|RPOC_GEOSM DNA-directed RNA polymerase subunit beta' OS=Geobacter sp. (strain M21) GN=rpoC PE=3 SV=1 2 859 3.0E-36
sp|Q04QJ0|RPOC_LEPBJ DNA-directed RNA polymerase subunit beta' OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=rpoC PE=3 SV=1 8 861 5.0E-36
sp|Q3J8Q8|RPOC_NITOC DNA-directed RNA polymerase subunit beta' OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=rpoC PE=3 SV=1 8 862 8.0E-36
sp|A5DCV3|RPB1_PICGU DNA-directed RNA polymerase II subunit RPB1 (Fragments) OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=RPB1 PE=3 SV=2 562 700 1.0E-35
sp|Q8F0S3|RPOC_LEPIN DNA-directed RNA polymerase subunit beta' OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=rpoC PE=3 SV=1 8 861 1.0E-35
sp|Q72UA7|RPOC_LEPIC DNA-directed RNA polymerase subunit beta' OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=rpoC PE=3 SV=1 8 861 1.0E-35
sp|Q054E1|RPOC_LEPBL DNA-directed RNA polymerase subunit beta' OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=rpoC PE=3 SV=1 8 861 2.0E-35
sp|A0AF64|RPOC_LISW6 DNA-directed RNA polymerase subunit beta' OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=rpoC PE=3 SV=1 8 872 4.0E-35
sp|A7HCH6|RPOC_ANADF DNA-directed RNA polymerase subunit beta' OS=Anaeromyxobacter sp. (strain Fw109-5) GN=rpoC PE=3 SV=1 2 859 6.0E-35
sp|Q9LQ02|NRPD1_ARATH DNA-directed RNA polymerase IV subunit 1 OS=Arabidopsis thaliana GN=NRPD1 PE=1 SV=1 110 693 9.0E-35
sp|B2V7L9|RPOC_SULSY DNA-directed RNA polymerase subunit beta' OS=Sulfurihydrogenibium sp. (strain YO3AOP1) GN=rpoC PE=3 SV=1 8 660 2.0E-34
sp|O35134|RPA1_MOUSE DNA-directed RNA polymerase I subunit RPA1 OS=Mus musculus GN=Polr1a PE=1 SV=2 1144 1361 4.0E-34
sp|B2GDX6|RPOC_LACF3 DNA-directed RNA polymerase subunit beta' OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=rpoC PE=3 SV=1 2 872 5.0E-34
sp|Q6MJ10|RPOC_BDEBA DNA-directed RNA polymerase subunit beta' OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=rpoC PE=3 SV=1 1 861 2.0E-33
sp|O54889|RPA1_RAT DNA-directed RNA polymerase I subunit RPA1 OS=Rattus norvegicus GN=Polr1a PE=1 SV=1 1133 1361 3.0E-33
sp|O95602|RPA1_HUMAN DNA-directed RNA polymerase I subunit RPA1 OS=Homo sapiens GN=POLR1A PE=1 SV=2 1140 1361 4.0E-33
sp|Q58445|RPOA1_METJA DNA-directed RNA polymerase subunit A' OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=rpoA1 PE=3 SV=2 2 336 1.0E-32
sp|Q9KWU6|RPOC_THEAQ DNA-directed RNA polymerase subunit beta' OS=Thermus aquaticus GN=rpoC PE=1 SV=2 1 872 2.0E-32
sp|B1YGU3|RPOC_EXIS2 DNA-directed RNA polymerase subunit beta' OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=rpoC PE=3 SV=1 8 872 5.0E-32
sp|C4LL70|RPOC_CORK4 DNA-directed RNA polymerase subunit beta' OS=Corynebacterium kroppenstedtii (strain DSM 44385 / CCUG 35717) GN=rpoC PE=3 SV=1 4 872 6.0E-32
sp|Q01VB2|RPOC_SOLUE DNA-directed RNA polymerase subunit beta' OS=Solibacter usitatus (strain Ellin6076) GN=rpoC PE=3 SV=1 2 859 7.0E-32
sp|Q72HM6|RPOC_THET2 DNA-directed RNA polymerase subunit beta' OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=rpoC PE=3 SV=2 1 688 9.0E-32
sp|Q8RQE8|RPOC_THET8 DNA-directed RNA polymerase subunit beta' OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=rpoC PE=1 SV=1 1 688 2.0E-31
sp|B4S498|RPOC_PROA2 DNA-directed RNA polymerase subunit beta' OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=rpoC PE=3 SV=1 2 855 3.0E-31
sp|Q5ZYP9|RPOC_LEGPH DNA-directed RNA polymerase subunit beta' OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=rpoC PE=3 SV=2 8 871 3.0E-31
sp|B0SSI3|RPOC_LEPBP DNA-directed RNA polymerase subunit beta' OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=rpoC PE=3 SV=1 4 675 3.0E-31
sp|B0SAG0|RPOC_LEPBA DNA-directed RNA polymerase subunit beta' OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=rpoC PE=3 SV=1 4 675 3.0E-31
sp|Q1J0P7|RPOC_DEIGD DNA-directed RNA polymerase subunit beta' OS=Deinococcus geothermalis (strain DSM 11300) GN=rpoC PE=3 SV=1 2 681 4.0E-31
sp|B1GZ76|RPOC_UNCTG DNA-directed RNA polymerase subunit beta' OS=Uncultured termite group 1 bacterium phylotype Rs-D17 GN=rpoC PE=3 SV=1 2 689 4.0E-31
sp|Q04C21|RPOC_LACDB DNA-directed RNA polymerase subunit beta' OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=rpoC PE=3 SV=1 2 689 4.0E-31
sp|Q5X865|RPOC_LEGPA DNA-directed RNA polymerase subunit beta' OS=Legionella pneumophila (strain Paris) GN=rpoC PE=3 SV=1 8 871 4.0E-31
sp|Q1GBM4|RPOC_LACDA DNA-directed RNA polymerase subunit beta' OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=rpoC PE=3 SV=1 2 689 5.0E-31
sp|A5IHS0|RPOC_LEGPC DNA-directed RNA polymerase subunit beta' OS=Legionella pneumophila (strain Corby) GN=rpoC PE=3 SV=2 8 871 5.0E-31
sp|Q3ILP8|RPOC_PSEHT DNA-directed RNA polymerase subunit beta' OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=rpoC PE=3 SV=1 2 859 7.0E-31
sp|Q8RHI7|RPOC_FUSNN DNA-directed RNA polymerase subunit beta' OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=rpoC PE=3 SV=1 2 855 7.0E-31
sp|P30761|RPOC_MYCLE DNA-directed RNA polymerase subunit beta' OS=Mycobacterium leprae (strain TN) GN=rpoC PE=3 SV=2 1 872 1.0E-30
sp|B8ZSC6|RPOC_MYCLB DNA-directed RNA polymerase subunit beta' OS=Mycobacterium leprae (strain Br4923) GN=rpoC PE=3 SV=1 1 872 1.0E-30
sp|Q8D232|RPOC_WIGBR DNA-directed RNA polymerase subunit beta' OS=Wigglesworthia glossinidia brevipalpis GN=rpoC PE=3 SV=1 2 859 1.0E-30
sp|A4XI31|RPOC_CALS8 DNA-directed RNA polymerase subunit beta' OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=rpoC PE=3 SV=2 2 872 1.0E-30
sp|Q9Z9M1|RPOC_BACHD DNA-directed RNA polymerase subunit beta' OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=rpoC PE=3 SV=1 2 872 1.0E-30
sp|B2TIG9|RPOC_CLOBB DNA-directed RNA polymerase subunit beta' OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=rpoC PE=3 SV=1 2 872 1.0E-30
sp|Q8YA96|RPOC_LISMO DNA-directed RNA polymerase subunit beta' OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=rpoC PE=3 SV=1 8 872 2.0E-30
sp|Q724E9|RPOC_LISMF DNA-directed RNA polymerase subunit beta' OS=Listeria monocytogenes serotype 4b (strain F2365) GN=rpoC PE=3 SV=1 8 872 2.0E-30
sp|P77879|RPOC_LISIN DNA-directed RNA polymerase subunit beta' OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=rpoC PE=3 SV=3 8 872 2.0E-30
sp|Q8ETY7|RPOC_OCEIH DNA-directed RNA polymerase subunit beta' OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=rpoC PE=3 SV=1 2 872 2.0E-30
sp|A8YXJ9|RPOC_LACH4 DNA-directed RNA polymerase subunit beta' OS=Lactobacillus helveticus (strain DPC 4571) GN=rpoC PE=3 SV=1 1 681 2.0E-30
sp|B4U738|RPOC_HYDS0 DNA-directed RNA polymerase subunit beta' OS=Hydrogenobaculum sp. (strain Y04AAS1) GN=rpoC PE=3 SV=1 2 674 3.0E-30
sp|Q65PB4|RPOC_BACLD DNA-directed RNA polymerase subunit beta' OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=rpoC PE=3 SV=1 2 872 4.0E-30
sp|Q6LLW3|RPOC_PHOPR DNA-directed RNA polymerase subunit beta' OS=Photobacterium profundum GN=rpoC PE=3 SV=2 2 859 5.0E-30
sp|B4UDT1|RPOC_ANASK DNA-directed RNA polymerase subunit beta' OS=Anaeromyxobacter sp. (strain K) GN=rpoC PE=3 SV=1 2 686 5.0E-30
sp|A8F977|RPOC_BACP2 DNA-directed RNA polymerase subunit beta' OS=Bacillus pumilus (strain SAFR-032) GN=rpoC PE=3 SV=1 2 872 7.0E-30
sp|Q03EB0|RPOC_PEDPA DNA-directed RNA polymerase subunit beta' OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=rpoC PE=3 SV=1 1 883 8.0E-30
sp|Q2II85|RPOC_ANADE DNA-directed RNA polymerase subunit beta' OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=rpoC PE=3 SV=1 8 686 1.0E-29
sp|P36252|RPOC_THEMA DNA-directed RNA polymerase subunit beta' OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=rpoC PE=3 SV=1 8 672 2.0E-29
sp|A6Q1M4|RPOC_NITSB DNA-directed RNA polymerase subunit beta' OS=Nitratiruptor sp. (strain SB155-2) GN=rpoC PE=3 SV=1 1 887 2.0E-29
sp|B9KBJ4|RPOC_THENN DNA-directed RNA polymerase subunit beta' OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=rpoC PE=3 SV=1 8 671 3.0E-29
sp|P37871|RPOC_BACSU DNA-directed RNA polymerase subunit beta' OS=Bacillus subtilis (strain 168) GN=rpoC PE=1 SV=4 2 872 3.0E-29
sp|Q9RVW0|RPOC_DEIRA DNA-directed RNA polymerase subunit beta' OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=rpoC PE=3 SV=1 2 872 4.0E-29
sp|O25806|RPOBC_HELPY Bifunctional DNA-directed RNA polymerase subunit beta-beta' OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=rpoBC PE=1 SV=1 2 675 4.0E-29
sp|Q820D6|RPOC_TROWT DNA-directed RNA polymerase subunit beta' OS=Tropheryma whipplei (strain Twist) GN=rpoC PE=3 SV=1 2 681 5.0E-29
sp|B1L934|RPOC_THESQ DNA-directed RNA polymerase subunit beta' OS=Thermotoga sp. (strain RQ2) GN=rpoC PE=3 SV=1 8 672 5.0E-29
sp|Q17VN6|RPOBC_HELAH Bifunctional DNA-directed RNA polymerase subunit beta-beta' OS=Helicobacter acinonychis (strain Sheeba) GN=rpoBC PE=3 SV=1 2 675 5.0E-29
sp|Q046D1|RPOC_LACGA DNA-directed RNA polymerase subunit beta' OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=rpoC PE=3 SV=1 8 681 5.0E-29
sp|Q820D9|RPOC_TROW8 DNA-directed RNA polymerase subunit beta' OS=Tropheryma whipplei (strain TW08/27) GN=rpoC PE=3 SV=2 2 681 5.0E-29
sp|Q0AF54|RPOC_NITEC DNA-directed RNA polymerase subunit beta' OS=Nitrosomonas eutropha (strain C91) GN=rpoC PE=3 SV=1 2 862 6.0E-29
sp|B3E164|RPOC_METI4 DNA-directed RNA polymerase subunit beta' OS=Methylacidiphilum infernorum (isolate V4) GN=rpoC PE=3 SV=1 8 660 7.0E-29
sp|Q1CS68|RPOBC_HELPH Bifunctional DNA-directed RNA polymerase subunit beta-beta' OS=Helicobacter pylori (strain HPAG1) GN=rpoBC PE=3 SV=1 2 675 9.0E-29
sp|B2UUV9|RPOBC_HELPS Bifunctional DNA-directed RNA polymerase subunit beta-beta' OS=Helicobacter pylori (strain Shi470) GN=rpoBC PE=3 SV=1 2 675 1.0E-28
sp|Q74L94|RPOC_LACJO DNA-directed RNA polymerase subunit beta' OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=rpoC PE=3 SV=1 8 681 1.0E-28
sp|Q9ZK23|RPOBC_HELPJ Bifunctional DNA-directed RNA polymerase subunit beta-beta' OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=rpoBC PE=3 SV=1 2 675 1.0E-28
sp|A5IJW2|RPOC_THEP1 DNA-directed RNA polymerase subunit beta' OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=rpoC PE=3 SV=1 8 672 1.0E-28
sp|Q5WLR9|RPOC_BACSK DNA-directed RNA polymerase subunit beta' OS=Bacillus clausii (strain KSM-K16) GN=rpoC PE=3 SV=1 8 700 1.0E-28
sp|P77882|RPOC_LISGR DNA-directed RNA polymerase subunit beta' (Fragment) OS=Listeria grayi GN=rpoC PE=3 SV=2 8 872 2.0E-28
sp|A1WVC8|RPOC_HALHL DNA-directed RNA polymerase subunit beta' OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=rpoC PE=3 SV=2 2 699 2.0E-28
sp|B1IGG1|RPOC_CLOBK DNA-directed RNA polymerase subunit beta' OS=Clostridium botulinum (strain Okra / Type B1) GN=rpoC PE=3 SV=1 2 700 2.0E-28
sp|A8EVZ3|RPOC_ARCB4 DNA-directed RNA polymerase subunit beta' OS=Arcobacter butzleri (strain RM4018) GN=rpoC PE=3 SV=1 1 862 3.0E-28
sp|B1KSN2|RPOC_CLOBM DNA-directed RNA polymerase subunit beta' OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=rpoC PE=3 SV=1 2 700 4.0E-28
sp|A6LKB7|RPOC_THEM4 DNA-directed RNA polymerase subunit beta' OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=rpoC PE=3 SV=1 1 731 5.0E-28
sp|A7GJ81|RPOC_CLOBL DNA-directed RNA polymerase subunit beta' OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=rpoC PE=3 SV=1 2 700 6.0E-28
sp|A6W5T1|RPOC_KINRD DNA-directed RNA polymerase subunit beta' OS=Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216) GN=rpoC PE=3 SV=1 1 684 6.0E-28
sp|A1T064|RPOC_PSYIN DNA-directed RNA polymerase subunit beta' OS=Psychromonas ingrahamii (strain 37) GN=rpoC PE=3 SV=1 2 859 7.0E-28
sp|Q03PV0|RPOC_LACBA DNA-directed RNA polymerase subunit beta' OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=rpoC PE=3 SV=1 8 313 9.0E-28
sp|Q73JJ8|RPOC_TREDE DNA-directed RNA polymerase subunit beta' OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=rpoC PE=3 SV=1 8 671 1.0E-27
sp|A2RML8|RPOC_LACLM DNA-directed RNA polymerase subunit beta' OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=rpoC PE=3 SV=1 8 872 2.0E-27
sp|B7ICR2|RPOC_THEAB DNA-directed RNA polymerase subunit beta' OS=Thermosipho africanus (strain TCF52B) GN=rpoC PE=3 SV=1 8 709 2.0E-27
sp|Q9CEN7|RPOC_LACLA DNA-directed RNA polymerase subunit beta' OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=rpoC PE=3 SV=2 8 872 3.0E-27
sp|A7HNY1|RPOC_FERNB DNA-directed RNA polymerase subunit beta' OS=Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) GN=rpoC PE=3 SV=1 8 660 4.0E-27
sp|A0Q866|RPOC_FRATN DNA-directed RNA polymerase subunit beta' OS=Francisella tularensis subsp. novicida (strain U112) GN=rpoC PE=3 SV=1 2 693 4.0E-27
sp|Q0BKC6|RPOC_FRATO DNA-directed RNA polymerase subunit beta' OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=rpoC PE=3 SV=1 2 693 4.0E-27
sp|Q2A1M8|RPOC_FRATH DNA-directed RNA polymerase subunit beta' OS=Francisella tularensis subsp. holarctica (strain LVS) GN=rpoC PE=3 SV=1 2 693 4.0E-27
sp|A1SEK2|RPOC_NOCSJ DNA-directed RNA polymerase subunit beta' OS=Nocardioides sp. (strain BAA-499 / JS614) GN=rpoC PE=3 SV=1 1 681 4.0E-27
sp|B2SFD7|RPOC_FRATM DNA-directed RNA polymerase subunit beta' OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=rpoC PE=3 SV=1 2 693 4.0E-27
sp|A4IWA0|RPOC_FRATW DNA-directed RNA polymerase subunit beta' OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=rpoC PE=3 SV=1 2 693 4.0E-27
sp|Q5NID1|RPOC_FRATT DNA-directed RNA polymerase subunit beta' OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=rpoC PE=3 SV=1 2 693 4.0E-27
sp|Q14JT4|RPOC_FRAT1 DNA-directed RNA polymerase subunit beta' OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=rpoC PE=3 SV=1 2 693 4.0E-27
sp|A6Q6I3|RPOC_SULNB DNA-directed RNA polymerase subunit beta' OS=Sulfurovum sp. (strain NBC37-1) GN=rpoC PE=3 SV=1 1 672 6.0E-27
sp|Q88XZ2|RPOC_LACPL DNA-directed RNA polymerase subunit beta' OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=rpoC PE=3 SV=1 8 313 9.0E-27
sp|B2A4D2|RPOC_NATTJ DNA-directed RNA polymerase subunit beta' OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=rpoC PE=3 SV=1 8 872 9.0E-27
sp|Q8EK73|RPOC_SHEON DNA-directed RNA polymerase subunit beta' OS=Shewanella oneidensis (strain MR-1) GN=rpoC PE=3 SV=1 8 675 1.0E-26
sp|Q0I0B1|RPOC_SHESR DNA-directed RNA polymerase subunit beta' OS=Shewanella sp. (strain MR-7) GN=rpoC PE=3 SV=1 8 675 1.0E-26
sp|Q0SQD7|RPOC_CLOPS DNA-directed RNA polymerase subunit beta' OS=Clostridium perfringens (strain SM101 / Type A) GN=rpoC PE=3 SV=1 8 692 1.0E-26
sp|P0C2E8|RPOC_CLOPE DNA-directed RNA polymerase subunit beta' OS=Clostridium perfringens (strain 13 / Type A) GN=rpoC PE=3 SV=1 8 692 1.0E-26
sp|Q0TMN9|RPOC_CLOP1 DNA-directed RNA polymerase subunit beta' OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=rpoC PE=3 SV=1 8 692 1.0E-26
sp|Q0HNU3|RPOC_SHESM DNA-directed RNA polymerase subunit beta' OS=Shewanella sp. (strain MR-4) GN=rpoC PE=3 SV=1 8 675 1.0E-26
sp|A0KRL8|RPOC_SHESA DNA-directed RNA polymerase subunit beta' OS=Shewanella sp. (strain ANA-3) GN=rpoC PE=3 SV=1 8 675 1.0E-26
sp|Q02X60|RPOC_LACLS DNA-directed RNA polymerase subunit beta' OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=rpoC PE=3 SV=1 8 872 1.0E-26
sp|Q2GD91|RPOC_NEOSM DNA-directed RNA polymerase subunit beta' OS=Neorickettsia sennetsu (strain Miyayama) GN=rpoC PE=3 SV=1 2 660 1.0E-26
sp|B3PM77|RPOC_MYCA5 DNA-directed RNA polymerase subunit beta' OS=Mycoplasma arthritidis (strain 158L3-1) GN=rpoC PE=3 SV=1 2 313 2.0E-26
sp|B0TX11|RPOC_FRAP2 DNA-directed RNA polymerase subunit beta' OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=rpoC PE=3 SV=1 2 693 3.0E-26
sp|Q65W40|RPOC_MANSM DNA-directed RNA polymerase subunit beta' OS=Mannheimia succiniciproducens (strain MBEL55E) GN=rpoC PE=3 SV=2 2 675 3.0E-26
sp|Q12SW5|RPOC_SHEDO DNA-directed RNA polymerase subunit beta' OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=rpoC PE=3 SV=1 8 702 4.0E-26
sp|Q8DS47|RPOC_STRMU DNA-directed RNA polymerase subunit beta' OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=rpoC PE=3 SV=2 8 313 4.0E-26
sp|Q89B21|RPOC_BUCBP DNA-directed RNA polymerase subunit beta' OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=rpoC PE=3 SV=1 2 675 4.0E-26
sp|B1ZPB7|RPOC_OPITP DNA-directed RNA polymerase subunit beta' OS=Opitutus terrae (strain DSM 11246 / PB90-1) GN=rpoC PE=3 SV=1 8 675 5.0E-26
sp|C0M7R5|RPOC_STRE4 DNA-directed RNA polymerase subunit beta' OS=Streptococcus equi subsp. equi (strain 4047) GN=rpoC PE=3 SV=1 8 313 5.0E-26
sp|Q7NQE7|RPOC_CHRVO DNA-directed RNA polymerase subunit beta' OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=rpoC PE=3 SV=1 2 860 5.0E-26
sp|A9KW96|RPOC_SHEB9 DNA-directed RNA polymerase subunit beta' OS=Shewanella baltica (strain OS195) GN=rpoC PE=3 SV=1 8 675 5.0E-26
sp|A6WHS2|RPOC_SHEB8 DNA-directed RNA polymerase subunit beta' OS=Shewanella baltica (strain OS185) GN=rpoC PE=3 SV=1 8 675 5.0E-26
sp|B8EBL1|RPOC_SHEB2 DNA-directed RNA polymerase subunit beta' OS=Shewanella baltica (strain OS223) GN=rpoC PE=3 SV=1 8 675 5.0E-26
sp|A1WK56|RPOC_VEREI DNA-directed RNA polymerase subunit beta' OS=Verminephrobacter eiseniae (strain EF01-2) GN=rpoC PE=3 SV=1 8 686 6.0E-26
sp|Q5FM96|RPOC_LACAC DNA-directed RNA polymerase subunit beta' OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=rpoC PE=3 SV=1 1 313 6.0E-26
sp|B2G8Y5|RPOC_LACRJ DNA-directed RNA polymerase subunit beta' OS=Lactobacillus reuteri (strain JCM 1112) GN=rpoC PE=3 SV=1 2 323 7.0E-26
sp|A5VLL3|RPOC_LACRD DNA-directed RNA polymerase subunit beta' OS=Lactobacillus reuteri (strain DSM 20016) GN=rpoC PE=3 SV=1 2 323 7.0E-26
sp|A1REA8|RPOC_SHESW DNA-directed RNA polymerase subunit beta' OS=Shewanella sp. (strain W3-18-1) GN=rpoC PE=3 SV=1 8 675 8.0E-26
sp|A4YBY9|RPOC_SHEPC DNA-directed RNA polymerase subunit beta' OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=rpoC PE=3 SV=1 8 675 8.0E-26
sp|Q8E238|RPOC_STRA5 DNA-directed RNA polymerase subunit beta' OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=rpoC PE=3 SV=1 8 313 8.0E-26
sp|Q8E7J7|RPOC_STRA3 DNA-directed RNA polymerase subunit beta' OS=Streptococcus agalactiae serotype III (strain NEM316) GN=rpoC PE=3 SV=1 8 313 8.0E-26
sp|Q3K3L1|RPOC_STRA1 DNA-directed RNA polymerase subunit beta' OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=rpoC PE=3 SV=1 8 313 8.0E-26
sp|Q06J18|RPOC1_BIGNA DNA-directed RNA polymerase subunit beta' OS=Bigelowiella natans GN=rpoC1 PE=3 SV=1 4 305 8.0E-26
sp|B3WAM7|RPOC_LACCB DNA-directed RNA polymerase subunit beta' OS=Lactobacillus casei (strain BL23) GN=rpoC PE=3 SV=1 2 313 1.0E-25
sp|Q034X1|RPOC_LACC3 DNA-directed RNA polymerase subunit beta' OS=Lactobacillus casei (strain ATCC 334) GN=rpoC PE=3 SV=1 2 313 1.0E-25
sp|B0S2E5|RPOC_FINM2 DNA-directed RNA polymerase subunit beta' OS=Finegoldia magna (strain ATCC 29328) GN=rpoC PE=3 SV=2 8 322 1.0E-25
sp|A4XZ96|RPOC_PSEMY DNA-directed RNA polymerase subunit beta' OS=Pseudomonas mendocina (strain ymp) GN=rpoC PE=3 SV=1 2 671 1.0E-25
sp|C0MEE4|RPOC_STRS7 DNA-directed RNA polymerase subunit beta' OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=rpoC PE=3 SV=1 8 313 1.0E-25
sp|Q88QP1|RPOC_PSEPK DNA-directed RNA polymerase subunit beta' OS=Pseudomonas putida (strain KT2440) GN=rpoC PE=3 SV=1 2 671 2.0E-25
sp|P94899|RPOC_LEUPS DNA-directed RNA polymerase subunit beta' (Fragment) OS=Leuconostoc pseudomesenteroides GN=rpoC PE=3 SV=1 8 313 2.0E-25
sp|Q1JNX6|RPOC_STRPC DNA-directed RNA polymerase subunit beta' OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=rpoC PE=3 SV=1 8 313 2.0E-25
sp|Q1JE19|RPOC_STRPB DNA-directed RNA polymerase subunit beta' OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=rpoC PE=3 SV=1 8 313 2.0E-25
sp|P0DF32|RPOC_STRP3 DNA-directed RNA polymerase subunit beta' OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=rpoC PE=3 SV=1 8 313 2.0E-25
sp|A5VXP1|RPOC_PSEP1 DNA-directed RNA polymerase subunit beta' OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=rpoC PE=3 SV=1 2 671 2.0E-25
sp|B9DSZ6|RPOC_STRU0 DNA-directed RNA polymerase subunit beta' OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=rpoC PE=3 SV=1 8 313 2.0E-25
sp|Q48VR0|RPOC_STRPM DNA-directed RNA polymerase subunit beta' OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=rpoC PE=3 SV=1 8 313 2.0E-25
sp|Q089R0|RPOC_SHEFN DNA-directed RNA polymerase subunit beta' OS=Shewanella frigidimarina (strain NCIMB 400) GN=rpoC PE=3 SV=1 8 702 2.0E-25
sp|Q1J8X0|RPOC_STRPF DNA-directed RNA polymerase subunit beta' OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=rpoC PE=3 SV=1 8 313 2.0E-25
sp|P0C0E0|RPOC_STRP1 DNA-directed RNA polymerase subunit beta' OS=Streptococcus pyogenes serotype M1 GN=rpoC PE=3 SV=1 8 313 2.0E-25
sp|P77917|RPOC_PEDAC DNA-directed RNA polymerase subunit beta' (Fragment) OS=Pediococcus acidilactici GN=rpoC PE=3 SV=2 2 313 2.0E-25
sp|Q8P2Y2|RPOC_STRP8 DNA-directed RNA polymerase subunit beta' OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=rpoC PE=3 SV=1 8 313 2.0E-25
sp|P0DF33|RPOC_STRPQ DNA-directed RNA polymerase subunit beta' OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=rpoC PE=3 SV=1 8 313 2.0E-25
sp|Q7MA56|RPOBC_WOLSU Bifunctional DNA-directed RNA polymerase subunit beta-beta' OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=rpoBC PE=3 SV=1 2 663 2.0E-25
sp|A4VSK3|RPOC_STRSY DNA-directed RNA polymerase subunit beta' OS=Streptococcus suis (strain 05ZYH33) GN=rpoC PE=3 SV=2 8 313 2.0E-25
sp|A4VYU4|RPOC_STRS2 DNA-directed RNA polymerase subunit beta' OS=Streptococcus suis (strain 98HAH33) GN=rpoC PE=3 SV=2 8 313 2.0E-25
sp|A2RC52|RPOC_STRPG DNA-directed RNA polymerase subunit beta' OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=rpoC PE=3 SV=1 8 313 2.0E-25
sp|Q38UQ3|RPOC_LACSS DNA-directed RNA polymerase subunit beta' OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=rpoC PE=3 SV=1 8 311 2.0E-25
sp|Q1JJ22|RPOC_STRPD DNA-directed RNA polymerase subunit beta' OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=rpoC PE=3 SV=1 8 313 2.0E-25
sp|Q5XE96|RPOC_STRP6 DNA-directed RNA polymerase subunit beta' OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=rpoC PE=3 SV=1 8 313 2.0E-25
sp|Q2GFP4|RPOC_EHRCR DNA-directed RNA polymerase subunit beta' OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=rpoC PE=3 SV=1 2 674 2.0E-25
sp|A8AZI2|RPOC_STRGC DNA-directed RNA polymerase subunit beta' OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=rpoC PE=3 SV=1 8 313 2.0E-25
sp|A3CKD4|RPOC_STRSV DNA-directed RNA polymerase subunit beta' OS=Streptococcus sanguinis (strain SK36) GN=rpoC PE=3 SV=1 8 313 2.0E-25
sp|A1S212|RPOC_SHEAM DNA-directed RNA polymerase subunit beta' OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=rpoC PE=3 SV=1 8 702 3.0E-25
sp|B1MVW7|RPOC_LEUCK DNA-directed RNA polymerase subunit beta' OS=Leuconostoc citreum (strain KM20) GN=rpoC PE=3 SV=1 8 313 3.0E-25
sp|A2SLG4|RPOC_METPP DNA-directed RNA polymerase subunit beta' OS=Methylibium petroleiphilum (strain PM1) GN=rpoC PE=3 SV=1 8 702 3.0E-25
sp|A5WH34|RPOC_PSYWF DNA-directed RNA polymerase subunit beta' OS=Psychrobacter sp. (strain PRwf-1) GN=rpoC PE=3 SV=1 4 675 3.0E-25
sp|Q6DAM9|RPOC_PECAS DNA-directed RNA polymerase subunit beta' OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=rpoC PE=3 SV=1 2 675 3.0E-25
sp|A5IZ52|RPOC_MYCAP DNA-directed RNA polymerase subunit beta' OS=Mycoplasma agalactiae (strain PG2) GN=rpoC PE=3 SV=1 3 313 3.0E-25
sp|P94892|RPOC_LEUMM DNA-directed RNA polymerase subunit beta' OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=rpoC PE=3 SV=2 8 313 3.0E-25
sp|B0VDH9|RPOC_ACIBY DNA-directed RNA polymerase subunit beta' OS=Acinetobacter baumannii (strain AYE) GN=rpoC PE=3 SV=1 8 860 3.0E-25
sp|A3M1G4|RPOC_ACIBT DNA-directed RNA polymerase subunit beta' OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=rpoC PE=3 SV=2 8 860 3.0E-25
sp|B2I1Z2|RPOC_ACIBC DNA-directed RNA polymerase subunit beta' OS=Acinetobacter baumannii (strain ACICU) GN=rpoC PE=3 SV=1 8 860 3.0E-25
sp|B5E2F2|RPOC_STRP4 DNA-directed RNA polymerase subunit beta' OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=rpoC PE=3 SV=1 8 313 4.0E-25
sp|C1CMQ7|RPOC_STRZP DNA-directed RNA polymerase subunit beta' OS=Streptococcus pneumoniae (strain P1031) GN=rpoC PE=3 SV=1 8 313 4.0E-25
sp|Q1LSX6|RPOC_BAUCH DNA-directed RNA polymerase subunit beta' OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=rpoC PE=3 SV=1 8 675 4.0E-25
sp|C1CTL3|RPOC_STRZT DNA-directed RNA polymerase subunit beta' OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=rpoC PE=3 SV=1 8 313 4.0E-25
sp|C1CGP3|RPOC_STRZJ DNA-directed RNA polymerase subunit beta' OS=Streptococcus pneumoniae (strain JJA) GN=rpoC PE=3 SV=1 8 313 4.0E-25
sp|B2IM39|RPOC_STRPS DNA-directed RNA polymerase subunit beta' OS=Streptococcus pneumoniae (strain CGSP14) GN=rpoC PE=3 SV=1 8 313 4.0E-25
sp|Q97NQ8|RPOC_STRPN DNA-directed RNA polymerase subunit beta' OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=rpoC PE=3 SV=1 8 313 4.0E-25
sp|B1I8R3|RPOC_STRPI DNA-directed RNA polymerase subunit beta' OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=rpoC PE=3 SV=1 8 313 4.0E-25
sp|C1CA05|RPOC_STRP7 DNA-directed RNA polymerase subunit beta' OS=Streptococcus pneumoniae (strain 70585) GN=rpoC PE=3 SV=1 8 313 4.0E-25
sp|P95405|RPOC_OENOE DNA-directed RNA polymerase subunit beta' (Fragment) OS=Oenococcus oeni GN=rpoC PE=3 SV=1 8 311 4.0E-25
sp|Q1IFX2|RPOC_PSEE4 DNA-directed RNA polymerase subunit beta' OS=Pseudomonas entomophila (strain L48) GN=rpoC PE=3 SV=1 2 671 4.0E-25
sp|Q48D30|RPOC_PSE14 DNA-directed RNA polymerase subunit beta' OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=rpoC PE=3 SV=1 2 671 4.0E-25
sp|Q2RFP0|RPOC_MOOTA DNA-directed RNA polymerase subunit beta' OS=Moorella thermoacetica (strain ATCC 39073) GN=rpoC PE=3 SV=1 2 313 4.0E-25
sp|B8ZNW6|RPOC_STRPJ DNA-directed RNA polymerase subunit beta' OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=rpoC PE=3 SV=1 8 313 4.0E-25
sp|Q04IK7|RPOC_STRP2 DNA-directed RNA polymerase subunit beta' OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=rpoC PE=3 SV=1 8 313 4.0E-25
sp|B1JDX0|RPOC_PSEPW DNA-directed RNA polymerase subunit beta' OS=Pseudomonas putida (strain W619) GN=rpoC PE=3 SV=1 2 671 4.0E-25
sp|Q8DNF1|RPOC_STRR6 DNA-directed RNA polymerase subunit beta' OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=rpoC PE=3 SV=1 8 313 4.0E-25
sp|A8G8E8|RPOC_SERP5 DNA-directed RNA polymerase subunit beta' OS=Serratia proteamaculans (strain 568) GN=rpoC PE=3 SV=1 2 675 4.0E-25
sp|Q5P338|RPOC_AROAE DNA-directed RNA polymerase subunit beta' OS=Aromatoleum aromaticum (strain EbN1) GN=rpoC PE=3 SV=1 8 675 4.0E-25
sp|B0KK61|RPOC_PSEPG DNA-directed RNA polymerase subunit beta' OS=Pseudomonas putida (strain GB-1) GN=rpoC PE=3 SV=1 2 671 5.0E-25
sp|Q9CK92|RPOC_PASMU DNA-directed RNA polymerase subunit beta' OS=Pasteurella multocida (strain Pm70) GN=rpoC PE=3 SV=1 2 675 5.0E-25
sp|Q0VSM1|RPOC_ALCBS DNA-directed RNA polymerase subunit beta' OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=rpoC PE=3 SV=1 2 673 5.0E-25
sp|Q04E86|RPOC_OENOB DNA-directed RNA polymerase subunit beta' OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=rpoC PE=3 SV=1 8 311 5.0E-25
sp|B0VLZ5|RPOC_ACIBS DNA-directed RNA polymerase subunit beta' OS=Acinetobacter baumannii (strain SDF) GN=rpoC PE=3 SV=1 8 860 6.0E-25
sp|A0LRL4|RPOC_ACIC1 DNA-directed RNA polymerase subunit beta' OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=rpoC PE=3 SV=1 8 313 6.0E-25
sp|Q6NJF6|RPOC_CORDI DNA-directed RNA polymerase subunit beta' OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=rpoC PE=3 SV=1 2 305 6.0E-25
sp|A3DIZ5|RPOC_CLOTH DNA-directed RNA polymerase subunit beta' OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=rpoC PE=3 SV=1 2 313 7.0E-25
sp|B1W441|RPOC_STRGG DNA-directed RNA polymerase subunit beta' OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=rpoC PE=3 SV=1 1 313 8.0E-25
sp|A5N4P0|RPOC_CLOK5 DNA-directed RNA polymerase subunit beta' OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=rpoC PE=3 SV=1 2 313 8.0E-25
sp|Q82DQ4|RPOC_STRAW DNA-directed RNA polymerase subunit beta' OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=rpoC PE=3 SV=1 8 313 9.0E-25
sp|Q6A6K7|RPOC_PROAC DNA-directed RNA polymerase subunit beta' OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=rpoC PE=3 SV=1 1 305 9.0E-25
sp|Q2JFI4|RPOC_FRASC DNA-directed RNA polymerase subunit beta' OS=Frankia sp. (strain CcI3) GN=rpoC PE=3 SV=1 1 305 9.0E-25
sp|Q8CJT1|RPOC_STRCO DNA-directed RNA polymerase subunit beta' OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=rpoC PE=3 SV=1 1 313 1.0E-24
sp|Q8XUZ9|RPOC_RALSO DNA-directed RNA polymerase subunit beta' OS=Ralstonia solanacearum (strain GMI1000) GN=rpoC PE=3 SV=1 2 675 1.0E-24
sp|Q0RRS9|RPOC_FRAAA DNA-directed RNA polymerase subunit beta' OS=Frankia alni (strain ACN14a) GN=rpoC PE=3 SV=1 1 305 1.0E-24
sp|A8LC63|RPOC_FRASN DNA-directed RNA polymerase subunit beta' OS=Frankia sp. (strain EAN1pec) GN=rpoC PE=3 SV=1 1 305 1.0E-24
sp|Q3YST4|RPOC_EHRCJ DNA-directed RNA polymerase subunit beta' OS=Ehrlichia canis (strain Jake) GN=rpoC PE=3 SV=1 2 674 1.0E-24
sp|P47716|RPOC_MYCGA DNA-directed RNA polymerase subunit beta' OS=Mycoplasma gallisepticum (strain R(low / passage 15 / clone 2)) GN=rpoC PE=3 SV=2 2 313 1.0E-24
sp|C5C0K2|RPOC_BEUC1 DNA-directed RNA polymerase subunit beta' OS=Beutenbergia cavernae (strain ATCC BAA-8 / DSM 12333 / NBRC 16432) GN=rpoC PE=3 SV=1 8 313 1.0E-24
sp|Q2NWR5|RPOC_SODGM DNA-directed RNA polymerase subunit beta' OS=Sodalis glossinidius (strain morsitans) GN=rpoC PE=3 SV=1 2 675 1.0E-24
sp|B5ZAZ4|RPOC_UREU1 DNA-directed RNA polymerase subunit beta' OS=Ureaplasma urealyticum serovar 10 (strain ATCC 33699 / Western) GN=rpoC PE=3 SV=1 4 325 2.0E-24
sp|Q7VJ82|RPOBC_HELHP Bifunctional DNA-directed RNA polymerase subunit beta-beta' OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=rpoBC PE=3 SV=1 2 326 2.0E-24
sp|B5RRJ6|RPOC_BORRA DNA-directed RNA polymerase subunit beta' OS=Borrelia recurrentis (strain A1) GN=rpoC PE=3 SV=1 68 685 2.0E-24
sp|Q0I5B8|RPOC_HAES1 DNA-directed RNA polymerase subunit beta' OS=Haemophilus somnus (strain 129Pt) GN=rpoC PE=3 SV=1 2 675 2.0E-24
sp|Q9PQV5|RPOC_UREPA DNA-directed RNA polymerase subunit beta' OS=Ureaplasma parvum serovar 3 (strain ATCC 700970) GN=rpoC PE=3 SV=1 4 325 2.0E-24
sp|B1AIH6|RPOC_UREP2 DNA-directed RNA polymerase subunit beta' OS=Ureaplasma parvum serovar 3 (strain ATCC 27815 / 27 / NCTC 11736) GN=rpoC PE=3 SV=1 4 325 2.0E-24
sp|B0URZ7|RPOC_HISS2 DNA-directed RNA polymerase subunit beta' OS=Histophilus somni (strain 2336) GN=rpoC PE=3 SV=1 2 675 2.0E-24
sp|A0QS66|RPOC_MYCS2 DNA-directed RNA polymerase subunit beta' OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=rpoC PE=1 SV=1 1 412 2.0E-24
sp|A1TVS9|RPOC_ACIAC DNA-directed RNA polymerase subunit beta' OS=Acidovorax citrulli (strain AAC00-1) GN=rpoC PE=3 SV=1 8 675 2.0E-24
sp|B2GIK0|RPOC_KOCRD DNA-directed RNA polymerase subunit beta' OS=Kocuria rhizophila (strain ATCC 9341 / DSM 348 / NBRC 103217 / DC2201) GN=rpoC PE=3 SV=1 1 346 2.0E-24
sp|Q5D869|NRPE1_ARATH DNA-directed RNA polymerase V subunit 1 OS=Arabidopsis thaliana GN=NRPE1 PE=1 SV=1 100 692 2.0E-24
sp|Q4QN34|RPOC_HAEI8 DNA-directed RNA polymerase subunit beta' OS=Haemophilus influenzae (strain 86-028NP) GN=rpoC PE=3 SV=1 2 675 3.0E-24
sp|A8MLD3|RPOC_ALKOO DNA-directed RNA polymerase subunit beta' OS=Alkaliphilus oremlandii (strain OhILAs) GN=rpoC PE=3 SV=1 2 313 3.0E-24
sp|A5U9X9|RPOC_HAEIE DNA-directed RNA polymerase subunit beta' OS=Haemophilus influenzae (strain PittEE) GN=rpoC PE=3 SV=1 2 675 3.0E-24
sp|A6VKC4|RPOC_ACTSZ DNA-directed RNA polymerase subunit beta' OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=rpoC PE=3 SV=1 2 675 3.0E-24
sp|B9MH46|RPOC_ACIET DNA-directed RNA polymerase subunit beta' OS=Acidovorax ebreus (strain TPSY) GN=rpoC PE=3 SV=1 8 686 3.0E-24
sp|Q890N5|RPOC_CLOTE DNA-directed RNA polymerase subunit beta' OS=Clostridium tetani (strain Massachusetts / E88) GN=rpoC PE=3 SV=2 2 313 3.0E-24
sp|A5UH19|RPOC_HAEIG DNA-directed RNA polymerase subunit beta' OS=Haemophilus influenzae (strain PittGG) GN=rpoC PE=3 SV=1 2 675 3.0E-24
sp|A1WCM8|RPOC_ACISJ DNA-directed RNA polymerase subunit beta' OS=Acidovorax sp. (strain JS42) GN=rpoC PE=3 SV=1 8 686 3.0E-24
sp|P43739|RPOC_HAEIN DNA-directed RNA polymerase subunit beta' OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=rpoC PE=3 SV=1 2 675 3.0E-24
sp|A9GRB4|RPOC_SORC5 DNA-directed RNA polymerase subunit beta' OS=Sorangium cellulosum (strain So ce56) GN=rpoC PE=3 SV=1 2 332 3.0E-24
sp|A3Q976|RPOC_SHELP DNA-directed RNA polymerase subunit beta' OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=rpoC PE=3 SV=1 8 675 4.0E-24
sp|A8M538|RPOC_SALAI DNA-directed RNA polymerase subunit beta' OS=Salinispora arenicola (strain CNS-205) GN=rpoC PE=3 SV=1 1 313 4.0E-24
sp|B2S091|RPOC_BORHD DNA-directed RNA polymerase subunit beta' OS=Borrelia hermsii (strain HS1 / DAH) GN=rpoC PE=3 SV=1 68 685 4.0E-24
sp|A4XBQ5|RPOC_SALTO DNA-directed RNA polymerase subunit beta' OS=Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / CNB-440) GN=rpoC PE=3 SV=1 1 313 4.0E-24
sp|B1HMZ5|RPOC_LYSSC DNA-directed RNA polymerase subunit beta' OS=Lysinibacillus sphaericus (strain C3-41) GN=rpoC PE=3 SV=2 8 313 4.0E-24
sp|B1MH61|RPOC_MYCA9 DNA-directed RNA polymerase subunit beta' OS=Mycobacterium abscessus (strain ATCC 19977 / DSM 44196 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543) GN=rpoC PE=3 SV=1 1 305 4.0E-24
sp|Q97EH0|RPOC_CLOAB DNA-directed RNA polymerase subunit beta' OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=rpoC PE=3 SV=1 8 313 4.0E-24
sp|B1VES2|RPOC_CORU7 DNA-directed RNA polymerase subunit beta' OS=Corynebacterium urealyticum (strain ATCC 43042 / DSM 7109) GN=rpoC PE=3 SV=1 2 305 5.0E-24
sp|Q47LI6|RPOC_THEFY DNA-directed RNA polymerase subunit beta' OS=Thermobifida fusca (strain YX) GN=rpoC PE=3 SV=1 1 313 5.0E-24
sp|Q4FQH4|RPOC_PSYA2 DNA-directed RNA polymerase subunit beta' OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=rpoC PE=3 SV=1 8 675 5.0E-24
sp|Q6MRX5|RPOC_MYCMS DNA-directed RNA polymerase subunit beta' OS=Mycoplasma mycoides subsp. mycoides SC (strain PG1) GN=rpoC PE=3 SV=1 8 663 6.0E-24
sp|Q5E239|RPOC_VIBF1 DNA-directed RNA polymerase subunit beta' OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=rpoC PE=3 SV=2 2 675 6.0E-24
sp|Q9J593|RP147_FOWPN DNA-directed RNA polymerase 147 kDa polypeptide OS=Fowlpox virus (strain NVSL) GN=RPO147 PE=3 SV=1 85 858 6.0E-24
sp|B5RLU8|RPOC_BORDL DNA-directed RNA polymerase subunit beta' OS=Borrelia duttonii (strain Ly) GN=rpoC PE=3 SV=1 68 685 7.0E-24
sp|Q1Q8Q0|RPOC_PSYCK DNA-directed RNA polymerase subunit beta' OS=Psychrobacter cryohalolentis (strain K5) GN=rpoC PE=3 SV=1 8 675 7.0E-24
sp|B2UQY1|RPOC_AKKM8 DNA-directed RNA polymerase subunit beta' OS=Akkermansia muciniphila (strain ATCC BAA-835 / Muc) GN=rpoC PE=3 SV=1 8 313 7.0E-24
sp|Q6B8R7|RPOC1_GRATL DNA-directed RNA polymerase subunit beta' OS=Gracilaria tenuistipitata var. liui GN=rpoC1 PE=3 SV=1 4 313 7.0E-24
sp|P27625|RPC1_PLAFA DNA-directed RNA polymerase III subunit RPC1 OS=Plasmodium falciparum PE=3 SV=1 4 175 8.0E-24
sp|A9VP70|RPOC_BACWK DNA-directed RNA polymerase subunit beta' OS=Bacillus weihenstephanensis (strain KBAB4) GN=rpoC PE=3 SV=1 2 313 8.0E-24
sp|Q81J47|RPOC_BACCR DNA-directed RNA polymerase subunit beta' OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=rpoC PE=3 SV=1 2 313 8.0E-24
sp|Q73FA3|RPOC_BACC1 DNA-directed RNA polymerase subunit beta' OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=rpoC PE=3 SV=1 2 313 8.0E-24
sp|A7GK13|RPOC_BACCN DNA-directed RNA polymerase subunit beta' OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=rpoC PE=3 SV=1 2 313 8.0E-24
sp|Q6HPR5|RPOC_BACHK DNA-directed RNA polymerase subunit beta' OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=rpoC PE=3 SV=1 8 313 8.0E-24
sp|A0R8H3|RPOC_BACAH DNA-directed RNA polymerase subunit beta' OS=Bacillus thuringiensis (strain Al Hakam) GN=rpoC PE=3 SV=1 8 313 8.0E-24
sp|A1QZH6|RPOC_BORT9 DNA-directed RNA polymerase subunit beta' OS=Borrelia turicatae (strain 91E135) GN=rpoC PE=3 SV=1 68 685 8.0E-24
sp|Q15YB0|RPOC_PSEA6 DNA-directed RNA polymerase subunit beta' OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=rpoC PE=3 SV=1 2 671 8.0E-24
sp|Q9KV29|RPOC_VIBCH DNA-directed RNA polymerase subunit beta' OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=rpoC PE=3 SV=1 2 663 8.0E-24
sp|A5F3P6|RPOC_VIBC3 DNA-directed RNA polymerase subunit beta' OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=rpoC PE=3 SV=1 2 663 8.0E-24
sp|A4IJI2|RPOC_GEOTN DNA-directed RNA polymerase subunit beta' OS=Geobacillus thermodenitrificans (strain NG80-2) GN=rpoC PE=3 SV=2 8 313 8.0E-24
sp|Q5SCX9|RPOC1_HUPLU DNA-directed RNA polymerase subunit beta' OS=Huperzia lucidula GN=rpoC1 PE=3 SV=1 4 305 8.0E-24
sp|Q63H97|RPOC_BACCZ DNA-directed RNA polymerase subunit beta' OS=Bacillus cereus (strain ZK / E33L) GN=rpoC PE=3 SV=1 2 313 9.0E-24
sp|P77819|RPOC_BACAN DNA-directed RNA polymerase subunit beta' OS=Bacillus anthracis GN=rpoC PE=3 SV=3 8 313 9.0E-24
sp|Q5L404|RPOC_GEOKA DNA-directed RNA polymerase subunit beta' OS=Geobacillus kaustophilus (strain HTA426) GN=rpoC PE=3 SV=1 8 313 9.0E-24
sp|Q85FR6|RPOC_CYAME Bifunctional DNA-directed RNA polymerase subunit beta'-beta'' OS=Cyanidioschyzon merolae GN=rpoC PE=3 SV=1 2 681 9.0E-24
sp|A0JZ92|RPOC_ARTS2 DNA-directed RNA polymerase subunit beta' OS=Arthrobacter sp. (strain FB24) GN=rpoC PE=3 SV=1 1 313 9.0E-24
sp|Q5FFD8|RPOC_EHRRG DNA-directed RNA polymerase subunit beta' OS=Ehrlichia ruminantium (strain Gardel) GN=rpoC PE=3 SV=1 2 674 9.0E-24
sp|A8G1F4|RPOC_SHESH DNA-directed RNA polymerase subunit beta' OS=Shewanella sediminis (strain HAW-EB3) GN=rpoC PE=3 SV=1 8 675 1.0E-23
sp|B8HD15|RPOC_ARTCA DNA-directed RNA polymerase subunit beta' OS=Arthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / JCM 12360 / NCIMB 13794 / A6) GN=rpoC PE=3 SV=1 1 313 1.0E-23
sp|A1R8V3|RPOC_ARTAT DNA-directed RNA polymerase subunit beta' OS=Arthrobacter aurescens (strain TC1) GN=rpoC PE=3 SV=1 1 313 1.0E-23
sp|A7MXF0|RPOC_VIBCB DNA-directed RNA polymerase subunit beta' OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=rpoC PE=3 SV=1 2 663 1.0E-23
sp|Q5M2F6|RPOC_STRT2 DNA-directed RNA polymerase subunit beta' OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=rpoC PE=3 SV=1 8 313 1.0E-23
sp|Q5LXV4|RPOC_STRT1 DNA-directed RNA polymerase subunit beta' OS=Streptococcus thermophilus (strain CNRZ 1066) GN=rpoC PE=3 SV=1 8 313 1.0E-23
sp|B0TM18|RPOC_SHEHH DNA-directed RNA polymerase subunit beta' OS=Shewanella halifaxensis (strain HAW-EB4) GN=rpoC PE=3 SV=1 8 675 1.0E-23
sp|Q03IK3|RPOC_STRTD DNA-directed RNA polymerase subunit beta' OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=rpoC PE=3 SV=1 8 313 1.0E-23
sp|Q4JT33|RPOC_CORJK DNA-directed RNA polymerase subunit beta' OS=Corynebacterium jeikeium (strain K411) GN=rpoC PE=3 SV=1 2 305 1.0E-23
sp|A8GYX0|RPOC_SHEPA DNA-directed RNA polymerase subunit beta' OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=rpoC PE=3 SV=1 8 675 1.0E-23
sp|Q5HC04|RPOC_EHRRW DNA-directed RNA polymerase subunit beta' OS=Ehrlichia ruminantium (strain Welgevonden) GN=rpoC PE=3 SV=1 2 674 1.0E-23
sp|C5CKF4|RPOC_VARPS DNA-directed RNA polymerase subunit beta' OS=Variovorax paradoxus (strain S110) GN=rpoC PE=3 SV=1 8 671 1.0E-23
sp|Q31IY8|RPOC_THICR DNA-directed RNA polymerase subunit beta' OS=Thiomicrospira crunogena (strain XCL-2) GN=rpoC PE=3 SV=1 2 702 1.0E-23
sp|B6YPZ6|RPOC_AZOPC DNA-directed RNA polymerase subunit beta' OS=Azobacteroides pseudotrichonymphae genomovar. CFP2 GN=rpoC PE=3 SV=1 2 313 2.0E-23
sp|Q8G515|RPOC_BIFLO DNA-directed RNA polymerase subunit beta' OS=Bifidobacterium longum (strain NCC 2705) GN=rpoC PE=3 SV=1 8 685 2.0E-23
sp|B3DTE1|RPOC_BIFLD DNA-directed RNA polymerase subunit beta' OS=Bifidobacterium longum (strain DJO10A) GN=rpoC PE=3 SV=1 8 685 2.0E-23
sp|A4FPP2|RPOC_SACEN DNA-directed RNA polymerase subunit beta' OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=rpoC PE=3 SV=1 1 305 2.0E-23
sp|Q7MGS0|RPOC_VIBVY DNA-directed RNA polymerase subunit beta' OS=Vibrio vulnificus (strain YJ016) GN=rpoC PE=3 SV=1 2 663 3.0E-23
sp|Q8DD19|RPOC_VIBVU DNA-directed RNA polymerase subunit beta' OS=Vibrio vulnificus (strain CMCP6) GN=rpoC PE=3 SV=1 2 663 3.0E-23
sp|Q21SF8|RPOC_RHOFT DNA-directed RNA polymerase subunit beta' OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=rpoC PE=3 SV=1 8 671 3.0E-23
sp|B3ETY9|RPOC_AMOA5 DNA-directed RNA polymerase subunit beta' OS=Amoebophilus asiaticus (strain 5a2) GN=rpoC PE=3 SV=1 7 313 3.0E-23
sp|Q2S906|RPOC_HAHCH DNA-directed RNA polymerase subunit beta' OS=Hahella chejuensis (strain KCTC 2396) GN=rpoC PE=3 SV=1 2 685 3.0E-23
sp|B2T758|RPOC_BURPP DNA-directed RNA polymerase subunit beta' OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=rpoC PE=3 SV=1 2 675 3.0E-23
sp|P77839|RPOC_BROTH DNA-directed RNA polymerase subunit beta' (Fragment) OS=Brochothrix thermosphacta GN=rpoC PE=3 SV=2 8 313 3.0E-23
sp|P60288|RPOC1_PHYPA DNA-directed RNA polymerase subunit beta' OS=Physcomitrella patens subsp. patens GN=rpoC1 PE=3 SV=1 4 311 3.0E-23
sp|B1KMY9|RPOC_SHEWM DNA-directed RNA polymerase subunit beta' OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=rpoC PE=3 SV=1 8 671 3.0E-23
sp|Q13TG3|RPOC_BURXL DNA-directed RNA polymerase subunit beta' OS=Burkholderia xenovorans (strain LB400) GN=rpoC PE=3 SV=1 2 675 3.0E-23
sp|Q6F0L8|RPOC_MESFL DNA-directed RNA polymerase subunit beta' OS=Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1) GN=rpoC PE=3 SV=1 8 313 4.0E-23
sp|Q8A470|RPOC_BACTN DNA-directed RNA polymerase subunit beta' OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=rpoC PE=3 SV=1 2 313 4.0E-23
sp|Q8R7U7|RPOC_CALS4 DNA-directed RNA polymerase subunit beta' OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=rpoC PE=3 SV=1 8 313 4.0E-23
sp|A0PXT9|RPOC_CLONN DNA-directed RNA polymerase subunit beta' OS=Clostridium novyi (strain NT) GN=rpoC PE=3 SV=1 2 313 4.0E-23
sp|P47582|RPOC_MYCGE DNA-directed RNA polymerase subunit beta' OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=rpoC PE=3 SV=1 3 313 4.0E-23
sp|A9BF32|RPOC_PETMO DNA-directed RNA polymerase subunit beta' OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=rpoC PE=3 SV=1 2 305 4.0E-23
sp|A6BM51|RPOC1_GNEPA DNA-directed RNA polymerase subunit beta' OS=Gnetum parvifolium GN=rpoC1 PE=3 SV=1 9 313 4.0E-23
sp|O78484|RPOC1_GUITH DNA-directed RNA polymerase subunit beta' OS=Guillardia theta GN=rpoC1 PE=3 SV=1 2 313 4.0E-23
sp|B2JIH3|RPOC_BURP8 DNA-directed RNA polymerase subunit beta' OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=rpoC PE=3 SV=1 2 675 5.0E-23
sp|Q85CL6|RPOC1_ANTFO DNA-directed RNA polymerase subunit beta' OS=Anthoceros formosae GN=rpoC1 PE=2 SV=1 4 332 5.0E-23
sp|B0K5G9|RPOC_THEPX DNA-directed RNA polymerase subunit beta' OS=Thermoanaerobacter sp. (strain X514) GN=rpoC PE=3 SV=2 8 313 5.0E-23
sp|Q87KQ5|RPOC_VIBPA DNA-directed RNA polymerase subunit beta' OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=rpoC PE=3 SV=1 2 663 6.0E-23
sp|P0C1T4|RPOC_STAAU DNA-directed RNA polymerase subunit beta' (Fragment) OS=Staphylococcus aureus GN=rpoC PE=3 SV=1 8 313 6.0E-23
sp|P75271|RPOC_MYCPN DNA-directed RNA polymerase subunit beta' OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=rpoC PE=3 SV=1 3 313 6.0E-23
sp|B0KCJ3|RPOC_THEP3 DNA-directed RNA polymerase subunit beta' OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=rpoC PE=3 SV=1 8 313 6.0E-23
sp|Q98Q24|RPOC_MYCPU DNA-directed RNA polymerase subunit beta' OS=Mycoplasma pulmonis (strain UAB CTIP) GN=rpoC PE=3 SV=1 2 374 6.0E-23
sp|Q64NJ8|RPOC_BACFR DNA-directed RNA polymerase subunit beta' OS=Bacteroides fragilis (strain YCH46) GN=rpoC PE=3 SV=1 2 313 6.0E-23
sp|Q5L898|RPOC_BACFN DNA-directed RNA polymerase subunit beta' OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=rpoC PE=3 SV=1 2 313 6.0E-23
sp|Q67JT4|RPOC_SYMTH DNA-directed RNA polymerase subunit beta' OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=rpoC PE=3 SV=1 2 305 7.0E-23
sp|A6TWI9|RPOC_ALKMQ DNA-directed RNA polymerase subunit beta' OS=Alkaliphilus metalliredigens (strain QYMF) GN=rpoC PE=3 SV=1 8 337 7.0E-23
sp|B3EL62|RPOC_CHLPB DNA-directed RNA polymerase subunit beta' OS=Chlorobium phaeobacteroides (strain BS1) GN=rpoC PE=3 SV=1 2 313 8.0E-23
sp|Q0P3M5|RPOC1_OSTTA DNA-directed RNA polymerase subunit beta' OS=Ostreococcus tauri GN=rpoC1 PE=3 SV=1 4 304 9.0E-23
sp|A6KYK2|RPOC_BACV8 DNA-directed RNA polymerase subunit beta' OS=Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154) GN=rpoC PE=3 SV=1 2 313 1.0E-22
sp|B2Y1V6|RPOC1_WELMI DNA-directed RNA polymerase subunit beta' OS=Welwitschia mirabilis GN=rpoC1 PE=3 SV=1 9 313 1.0E-22
sp|P06273|RPOC1_MARPO DNA-directed RNA polymerase subunit beta' OS=Marchantia polymorpha GN=rpoC1 PE=3 SV=1 4 311 1.0E-22
sp|Q39Y12|RPOC_GEOMG DNA-directed RNA polymerase subunit beta' OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=rpoC PE=3 SV=1 2 347 1.0E-22
sp|P60286|RPOC_STAAW DNA-directed RNA polymerase subunit beta' OS=Staphylococcus aureus (strain MW2) GN=rpoC PE=3 SV=1 8 313 1.0E-22
sp|Q6GBU4|RPOC_STAAS DNA-directed RNA polymerase subunit beta' OS=Staphylococcus aureus (strain MSSA476) GN=rpoC PE=3 SV=1 8 313 1.0E-22
sp|P60285|RPOC_STAAN DNA-directed RNA polymerase subunit beta' OS=Staphylococcus aureus (strain N315) GN=rpoC PE=1 SV=1 8 313 1.0E-22
sp|P60284|RPOC_STAAM DNA-directed RNA polymerase subunit beta' OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=rpoC PE=3 SV=1 8 313 1.0E-22
sp|Q5HID2|RPOC_STAAC DNA-directed RNA polymerase subunit beta' OS=Staphylococcus aureus (strain COL) GN=rpoC PE=3 SV=1 8 313 1.0E-22
sp|Q2G0N5|RPOC_STAA8 DNA-directed RNA polymerase subunit beta' OS=Staphylococcus aureus (strain NCTC 8325) GN=rpoC PE=3 SV=2 8 313 1.0E-22
sp|Q6GJC5|RPOC_STAAR DNA-directed RNA polymerase subunit beta' OS=Staphylococcus aureus (strain MRSA252) GN=rpoC PE=3 SV=1 8 313 1.0E-22
sp|Q2YSB8|RPOC_STAAB DNA-directed RNA polymerase subunit beta' OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=rpoC PE=3 SV=1 8 313 1.0E-22
sp|Q2FJ97|RPOC_STAA3 DNA-directed RNA polymerase subunit beta' OS=Staphylococcus aureus (strain USA300) GN=rpoC PE=3 SV=2 8 313 2.0E-22
sp|Q4L3K4|RPOC_STAHJ DNA-directed RNA polymerase subunit beta' OS=Staphylococcus haemolyticus (strain JCSC1435) GN=rpoC PE=3 SV=1 8 313 2.0E-22
sp|Q8CQ83|RPOC_STAES DNA-directed RNA polymerase subunit beta' OS=Staphylococcus epidermidis (strain ATCC 12228) GN=rpoC PE=3 SV=1 8 313 2.0E-22
sp|Q5HRK9|RPOC_STAEQ DNA-directed RNA polymerase subunit beta' OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=rpoC PE=3 SV=1 8 313 2.0E-22
sp|A9BR99|RPOC_DELAS DNA-directed RNA polymerase subunit beta' OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=rpoC PE=3 SV=1 8 675 2.0E-22
sp|Q3B1H8|RPOC_CHLL7 DNA-directed RNA polymerase subunit beta' OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=rpoC PE=3 SV=1 2 313 2.0E-22
sp|A1BD24|RPOC_CHLPD DNA-directed RNA polymerase subunit beta' OS=Chlorobium phaeobacteroides (strain DSM 266) GN=rpoC PE=3 SV=1 8 313 2.0E-22
sp|Q2S1Q6|RPOC_SALRD DNA-directed RNA polymerase subunit beta' OS=Salinibacter ruber (strain DSM 13855 / M31) GN=rpoC PE=3 SV=1 2 313 2.0E-22
sp|Q49V53|RPOC_STAS1 DNA-directed RNA polymerase subunit beta' OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=rpoC PE=3 SV=1 8 313 2.0E-22
sp|A0T0D8|RPOC1_PHATC DNA-directed RNA polymerase subunit beta' OS=Phaeodactylum tricornutum (strain CCAP 1055/1) GN=rpoC1 PE=3 SV=1 2 313 2.0E-22
sp|B3EER3|RPOC_CHLL2 DNA-directed RNA polymerase subunit beta' OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=rpoC PE=3 SV=1 2 313 3.0E-22
sp|A1AX74|RPOC_RUTMC DNA-directed RNA polymerase subunit beta' OS=Ruthia magnifica subsp. Calyptogena magnifica GN=rpoC PE=3 SV=1 8 337 3.0E-22
sp|A8F4G1|RPOC_PSELT DNA-directed RNA polymerase subunit beta' OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=rpoC PE=3 SV=1 68 709 3.0E-22
sp|Q8EWX0|RPOC_MYCPE DNA-directed RNA polymerase subunit beta' OS=Mycoplasma penetrans (strain HF-2) GN=rpoC PE=3 SV=1 2 313 3.0E-22
sp|P51251|RPOC1_PORPU DNA-directed RNA polymerase subunit beta' OS=Porphyra purpurea GN=rpoC1 PE=3 SV=1 1 332 3.0E-22
sp|Q8DL56|RPOC1_THEEB DNA-directed RNA polymerase subunit gamma OS=Thermosynechococcus elongatus (strain BP-1) GN=rpoC1 PE=3 SV=1 2 346 4.0E-22
sp|P74177|RPOC1_SYNY3 DNA-directed RNA polymerase subunit gamma OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=rpoC1 PE=3 SV=1 8 313 4.0E-22
sp|O51349|RPOC_BORBU DNA-directed RNA polymerase subunit beta' OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=rpoC PE=3 SV=1 68 685 4.0E-22
sp|B7J1W0|RPOC_BORBZ DNA-directed RNA polymerase subunit beta' OS=Borrelia burgdorferi (strain ZS7) GN=rpoC PE=3 SV=1 68 685 4.0E-22
sp|B2S2I9|RPOC_TREPS DNA-directed RNA polymerase subunit beta' OS=Treponema pallidum subsp. pallidum (strain SS14) GN=rpoC PE=3 SV=1 2 329 4.0E-22
sp|O83270|RPOC_TREPA DNA-directed RNA polymerase subunit beta' OS=Treponema pallidum (strain Nichols) GN=rpoC PE=3 SV=1 2 329 4.0E-22
sp|Q05FH9|RPOC_CARRP DNA-directed RNA polymerase subunit beta' OS=Carsonella ruddii (strain PV) GN=rpoC PE=3 SV=1 9 313 4.0E-22
sp|Q06RE0|RPOC1_JASNU DNA-directed RNA polymerase subunit beta' OS=Jasminum nudiflorum GN=rpoC1 PE=3 SV=2 8 313 4.0E-22
sp|A6LE80|RPOC_PARD8 DNA-directed RNA polymerase subunit beta' OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=rpoC PE=3 SV=1 2 313 4.0E-22
sp|Q2ST47|RPOC_MYCCT DNA-directed RNA polymerase subunit beta' OS=Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154) GN=rpoC PE=3 SV=1 8 313 4.0E-22
sp|P19176|RPOC_PSEPU DNA-directed RNA polymerase subunit beta' OS=Pseudomonas putida GN=rpoC PE=3 SV=3 2 671 5.0E-22
sp|Q83ET0|RPOC_COXBU DNA-directed RNA polymerase subunit beta' OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=rpoC PE=3 SV=1 2 330 5.0E-22
sp|A9NAL6|RPOC_COXBR DNA-directed RNA polymerase subunit beta' OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=rpoC PE=3 SV=1 2 330 5.0E-22
sp|A9KD37|RPOC_COXBN DNA-directed RNA polymerase subunit beta' OS=Coxiella burnetii (strain Dugway 5J108-111) GN=rpoC PE=3 SV=1 2 330 5.0E-22
sp|Q7MX26|RPOC_PORGI DNA-directed RNA polymerase subunit beta' OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=rpoC PE=3 SV=1 8 313 5.0E-22
sp|B2RL44|RPOC_PORG3 DNA-directed RNA polymerase subunit beta' OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=rpoC PE=3 SV=1 8 313 5.0E-22
sp|B3QQS1|RPOC_CHLP8 DNA-directed RNA polymerase subunit beta' OS=Chlorobaculum parvum (strain NCIB 8327) GN=rpoC PE=3 SV=1 2 337 5.0E-22
sp|B4SG10|RPOC_PELPB DNA-directed RNA polymerase subunit beta' OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=rpoC PE=3 SV=1 2 313 5.0E-22
sp|B0JSN9|RPOC1_MICAN DNA-directed RNA polymerase subunit gamma OS=Microcystis aeruginosa (strain NIES-843) GN=rpoC1 PE=3 SV=1 2 313 6.0E-22
sp|A0T0R0|RPOC1_THAPS DNA-directed RNA polymerase subunit beta' OS=Thalassiosira pseudonana GN=rpoC1 PE=3 SV=1 2 313 6.0E-22
sp|Q7NDF8|RPOC1_GLOVI DNA-directed RNA polymerase subunit gamma OS=Gloeobacter violaceus (strain PCC 7421) GN=rpoC1 PE=3 SV=1 1 313 6.0E-22
sp|B1WP07|RPOC1_CYAA5 DNA-directed RNA polymerase subunit gamma OS=Cyanothece sp. (strain ATCC 51142) GN=rpoC1 PE=3 SV=1 8 313 6.0E-22
sp|A4SGK5|RPOC_CHLPM DNA-directed RNA polymerase subunit beta' OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=rpoC PE=3 SV=1 2 313 7.0E-22
sp|Q3ZJ92|RPOC1_PSEAK DNA-directed RNA polymerase subunit beta' OS=Pseudendoclonium akinetum GN=rpoC1 PE=3 SV=1 4 313 7.0E-22
sp|B3PK31|RPOC_CELJU DNA-directed RNA polymerase subunit beta' OS=Cellvibrio japonicus (strain Ueda107) GN=rpoC PE=3 SV=2 8 330 7.0E-22
sp|B3CV54|RPOC_ORITI DNA-directed RNA polymerase subunit beta' OS=Orientia tsutsugamushi (strain Ikeda) GN=rpoC PE=3 SV=1 2 305 7.0E-22
sp|A5CC92|RPOC_ORITB DNA-directed RNA polymerase subunit beta' OS=Orientia tsutsugamushi (strain Boryong) GN=rpoC PE=3 SV=1 2 305 7.0E-22
sp|Q661N0|RPOC_BORBP DNA-directed RNA polymerase subunit beta' OS=Borrelia bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi) GN=rpoC PE=3 SV=1 68 685 7.0E-22
sp|Q1XDN6|RPOC1_PYRYE DNA-directed RNA polymerase subunit beta' OS=Pyropia yezoensis GN=rpoC1 PE=3 SV=1 1 313 8.0E-22
sp|Q55085|RPOC1_SYNP2 DNA-directed RNA polymerase subunit gamma OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=rpoC1 PE=3 SV=2 1 329 8.0E-22
sp|Q5NPK4|RPOC_ZYMMO DNA-directed RNA polymerase subunit beta' OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=rpoC PE=3 SV=2 2 313 8.0E-22
sp|Q8KG14|RPOC_CHLTE DNA-directed RNA polymerase subunit beta' OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=rpoC PE=3 SV=1 2 337 9.0E-22
sp|A5CW24|RPOC_VESOH DNA-directed RNA polymerase subunit beta' OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=rpoC PE=3 SV=1 9 330 9.0E-22
sp|Q30TP6|RPOC_SULDN DNA-directed RNA polymerase subunit beta' OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=rpoC PE=3 SV=1 8 313 1.0E-21
sp|A2T323|RPOC1_ANGEV DNA-directed RNA polymerase subunit beta' OS=Angiopteris evecta GN=rpoC1 PE=3 SV=1 9 311 1.0E-21
sp|Q20EX2|RPOC1_OLTVI DNA-directed RNA polymerase subunit beta' OS=Oltmannsiellopsis viridis GN=rpoC1 PE=3 SV=1 4 344 1.0E-21
sp|B2J199|RPOC1_NOSP7 DNA-directed RNA polymerase subunit gamma OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=rpoC1 PE=3 SV=1 2 329 1.0E-21
sp|B1XSP4|RPOC_POLNS DNA-directed RNA polymerase subunit beta' OS=Polynucleobacter necessarius subsp. necessarius (strain STIR1) GN=rpoC PE=3 SV=1 2 660 1.0E-21
sp|Q110H2|RPOC1_TRIEI DNA-directed RNA polymerase subunit gamma OS=Trichodesmium erythraeum (strain IMS101) GN=rpoC1 PE=3 SV=1 1 313 1.0E-21
sp|B3QYL5|RPOC_CHLT3 DNA-directed RNA polymerase subunit beta' OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=rpoC PE=3 SV=1 2 330 1.0E-21
sp|Q3ATP4|RPOC_CHLCH DNA-directed RNA polymerase subunit beta' OS=Chlorobium chlorochromatii (strain CaD3) GN=rpoC PE=3 SV=1 2 313 1.0E-21
sp|B7JWQ8|RPOC1_CYAP8 DNA-directed RNA polymerase subunit gamma OS=Cyanothece sp. (strain PCC 8801) GN=rpoC1 PE=3 SV=1 2 313 1.0E-21
sp|A6MVX3|RPOC1_RHDSA DNA-directed RNA polymerase subunit beta' OS=Rhodomonas salina GN=rpoC1 PE=3 SV=1 2 313 1.0E-21
sp|Q60A05|RPOC_METCA DNA-directed RNA polymerase subunit beta' OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=rpoC PE=3 SV=1 2 330 2.0E-21
sp|Q1AU23|RPOC_RUBXD DNA-directed RNA polymerase subunit beta' OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=rpoC PE=3 SV=1 1 313 2.0E-21
sp|B0U5X6|RPOC_XYLFM DNA-directed RNA polymerase subunit beta' OS=Xylella fastidiosa (strain M12) GN=rpoC PE=3 SV=1 2 305 2.0E-21
sp|Q87A33|RPOC_XYLFT DNA-directed RNA polymerase subunit beta' OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=rpoC PE=3 SV=1 2 305 2.0E-21
sp|B2IA67|RPOC_XYLF2 DNA-directed RNA polymerase subunit beta' OS=Xylella fastidiosa (strain M23) GN=rpoC PE=3 SV=1 2 305 2.0E-21
sp|A4QKI3|RPOC1_CAPBU DNA-directed RNA polymerase subunit beta' OS=Capsella bursa-pastoris GN=rpoC1 PE=3 SV=1 9 311 2.0E-21
sp|Q3M5C9|RPOC1_ANAVT DNA-directed RNA polymerase subunit gamma OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=rpoC1 PE=3 SV=1 2 329 2.0E-21
sp|A4QL97|RPOC1_LEPVR DNA-directed RNA polymerase subunit beta' OS=Lepidium virginicum GN=rpoC1 PE=3 SV=1 9 311 2.0E-21
sp|Q7N9A3|RPOC_PHOLL DNA-directed RNA polymerase subunit beta' OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=rpoC PE=3 SV=1 2 330 2.0E-21
sp|A4QJS4|RPOC1_OLIPU DNA-directed RNA polymerase subunit beta' OS=Olimarabidopsis pumila GN=rpoC1 PE=3 SV=1 9 311 2.0E-21
sp|A4QK96|RPOC1_BARVE DNA-directed RNA polymerase subunit beta' OS=Barbarea verna GN=rpoC1 PE=3 SV=1 9 311 2.0E-21
sp|P35084|RPB1_DICDI DNA-directed RNA polymerase II subunit rpb1 OS=Dictyostelium discoideum GN=polr2a PE=2 SV=2 819 887 2.0E-19
sp|A5DCV3|RPB1_PICGU DNA-directed RNA polymerase II subunit RPB1 (Fragments) OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=RPB1 PE=3 SV=2 819 887 2.0E-19
sp|P16356|RPB1_CAEEL DNA-directed RNA polymerase II subunit RPB1 OS=Caenorhabditis elegans GN=ama-1 PE=1 SV=3 819 887 2.0E-18
sp|P14248|RPB1_PLAFD DNA-directed RNA polymerase II subunit RPB1 OS=Plasmodium falciparum (isolate CDC / Honduras) GN=RPII PE=3 SV=1 820 887 6.0E-18
sp|P04050|RPB1_YEAST DNA-directed RNA polymerase II subunit RPB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPO21 PE=1 SV=2 791 887 1.0E-17
sp|Q75A34|RPB1_ASHGO DNA-directed RNA polymerase II subunit RPB1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RPB1 PE=3 SV=2 819 887 1.0E-17
sp|P25202|RPC1_GIAIN DNA-directed RNA polymerase III subunit RPC1 OS=Giardia intestinalis GN=RPOA3 PE=3 SV=1 3 172 2.0E-17
sp|P35084|RPB1_DICDI DNA-directed RNA polymerase II subunit rpb1 OS=Dictyostelium discoideum GN=polr2a PE=2 SV=2 1189 1354 5.0E-17
sp|P36594|RPB1_SCHPO DNA-directed RNA polymerase II subunit rpb1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpb1 PE=1 SV=1 1169 1354 3.0E-16
sp|P04052|RPB1_DROME DNA-directed RNA polymerase II subunit RPB1 OS=Drosophila melanogaster GN=RpII215 PE=3 SV=4 1213 1355 3.0E-16
sp|Q7T6X5|RPO1_MIMIV DNA-directed RNA polymerase subunit 1 OS=Acanthamoeba polyphaga mimivirus GN=RPO1 PE=1 SV=2 1221 1355 3.0E-16
sp|P27625|RPC1_PLAFA DNA-directed RNA polymerase III subunit RPC1 OS=Plasmodium falciparum PE=3 SV=1 819 886 4.0E-16
sp|P04050|RPB1_YEAST DNA-directed RNA polymerase II subunit RPB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPO21 PE=1 SV=2 1184 1355 6.0E-16
sp|P04051|RPC1_YEAST DNA-directed RNA polymerase III subunit RPC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPO31 PE=1 SV=1 1184 1355 1.0E-15
sp|P04052|RPB1_DROME DNA-directed RNA polymerase II subunit RPB1 OS=Drosophila melanogaster GN=RpII215 PE=3 SV=4 819 887 1.0E-15
sp|P14248|RPB1_PLAFD DNA-directed RNA polymerase II subunit RPB1 OS=Plasmodium falciparum (isolate CDC / Honduras) GN=RPII PE=3 SV=1 1216 1355 1.0E-15
sp|Q75A34|RPB1_ASHGO DNA-directed RNA polymerase II subunit RPB1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RPB1 PE=3 SV=2 1169 1355 2.0E-15
sp|P08968|RPC1_TRYBB DNA-directed RNA polymerase III subunit RPC1 OS=Trypanosoma brucei brucei PE=3 SV=1 805 885 8.0E-15
sp|P18616|NRPB1_ARATH DNA-directed RNA polymerase II subunit 1 OS=Arabidopsis thaliana GN=NRPB1 PE=1 SV=3 1214 1354 2.0E-14
sp|Q86AQ5|RPC1_DICDI DNA-directed RNA polymerase III subunit rpc1 OS=Dictyostelium discoideum GN=polr3a PE=3 SV=1 819 885 2.0E-14
sp|P08775|RPB1_MOUSE DNA-directed RNA polymerase II subunit RPB1 OS=Mus musculus GN=Polr2a PE=1 SV=3 1214 1355 2.0E-14
sp|P24928|RPB1_HUMAN DNA-directed RNA polymerase II subunit RPB1 OS=Homo sapiens GN=POLR2A PE=1 SV=2 1214 1355 2.0E-14
sp|Q8SSC4|RPB1_ENCCU DNA-directed RNA polymerase II subunit RPB1 OS=Encephalitozoon cuniculi (strain GB-M1) GN=RPB1 PE=3 SV=1 819 887 2.0E-14
sp|P16356|RPB1_CAEEL DNA-directed RNA polymerase II subunit RPB1 OS=Caenorhabditis elegans GN=ama-1 PE=1 SV=3 1234 1355 3.0E-14
sp|A4FPP2|RPOC_SACEN DNA-directed RNA polymerase subunit beta' OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=rpoC PE=3 SV=1 551 872 8.0E-14
sp|P35074|RPB1_CAEBR DNA-directed RNA polymerase II subunit RPB1 OS=Caenorhabditis briggsae GN=rpb-1 PE=3 SV=2 1234 1355 9.0E-14
sp|Q03IK3|RPOC_STRTD DNA-directed RNA polymerase subunit beta' OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=rpoC PE=3 SV=1 555 872 9.0E-14
sp|Q6BI69|RPC1_DEBHA DNA-directed RNA polymerase III subunit RPC1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=RPC1 PE=3 SV=2 1184 1365 1.0E-13
sp|Q5M2F6|RPOC_STRT2 DNA-directed RNA polymerase subunit beta' OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=rpoC PE=3 SV=1 555 872 1.0E-13
sp|Q5LXV4|RPOC_STRT1 DNA-directed RNA polymerase subunit beta' OS=Streptococcus thermophilus (strain CNRZ 1066) GN=rpoC PE=3 SV=1 555 872 1.0E-13
sp|Q8E238|RPOC_STRA5 DNA-directed RNA polymerase subunit beta' OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=rpoC PE=3 SV=1 555 872 2.0E-13
sp|Q8E7J7|RPOC_STRA3 DNA-directed RNA polymerase subunit beta' OS=Streptococcus agalactiae serotype III (strain NEM316) GN=rpoC PE=3 SV=1 555 872 2.0E-13
sp|Q3K3L1|RPOC_STRA1 DNA-directed RNA polymerase subunit beta' OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=rpoC PE=3 SV=1 555 872 2.0E-13
sp|Q4L3K4|RPOC_STAHJ DNA-directed RNA polymerase subunit beta' OS=Staphylococcus haemolyticus (strain JCSC1435) GN=rpoC PE=3 SV=1 554 872 2.0E-13
sp|Q81J47|RPOC_BACCR DNA-directed RNA polymerase subunit beta' OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=rpoC PE=3 SV=1 561 872 3.0E-13
sp|Q73FA3|RPOC_BACC1 DNA-directed RNA polymerase subunit beta' OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=rpoC PE=3 SV=1 561 872 3.0E-13
sp|P77839|RPOC_BROTH DNA-directed RNA polymerase subunit beta' (Fragment) OS=Brochothrix thermosphacta GN=rpoC PE=3 SV=2 621 872 3.0E-13
sp|Q6HPR5|RPOC_BACHK DNA-directed RNA polymerase subunit beta' OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=rpoC PE=3 SV=1 561 872 4.0E-13
sp|A0R8H3|RPOC_BACAH DNA-directed RNA polymerase subunit beta' OS=Bacillus thuringiensis (strain Al Hakam) GN=rpoC PE=3 SV=1 561 872 4.0E-13
sp|Q63H97|RPOC_BACCZ DNA-directed RNA polymerase subunit beta' OS=Bacillus cereus (strain ZK / E33L) GN=rpoC PE=3 SV=1 561 872 4.0E-13
sp|P77819|RPOC_BACAN DNA-directed RNA polymerase subunit beta' OS=Bacillus anthracis GN=rpoC PE=3 SV=3 561 872 4.0E-13
sp|A4VSK3|RPOC_STRSY DNA-directed RNA polymerase subunit beta' OS=Streptococcus suis (strain 05ZYH33) GN=rpoC PE=3 SV=2 555 872 5.0E-13
sp|A4VYU4|RPOC_STRS2 DNA-directed RNA polymerase subunit beta' OS=Streptococcus suis (strain 98HAH33) GN=rpoC PE=3 SV=2 555 872 5.0E-13
sp|A5IZ52|RPOC_MYCAP DNA-directed RNA polymerase subunit beta' OS=Mycoplasma agalactiae (strain PG2) GN=rpoC PE=3 SV=1 555 872 5.0E-13
sp|A5DCV3|RPB1_PICGU DNA-directed RNA polymerase II subunit RPB1 (Fragments) OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=RPB1 PE=3 SV=2 1214 1356 6.0E-13
sp|Q47LI6|RPOC_THEFY DNA-directed RNA polymerase subunit beta' OS=Thermobifida fusca (strain YX) GN=rpoC PE=3 SV=1 540 892 6.0E-13
sp|B1HMZ5|RPOC_LYSSC DNA-directed RNA polymerase subunit beta' OS=Lysinibacillus sphaericus (strain C3-41) GN=rpoC PE=3 SV=2 554 872 7.0E-13
sp|Q5L404|RPOC_GEOKA DNA-directed RNA polymerase subunit beta' OS=Geobacillus kaustophilus (strain HTA426) GN=rpoC PE=3 SV=1 561 872 7.0E-13
sp|Q8CQ83|RPOC_STAES DNA-directed RNA polymerase subunit beta' OS=Staphylococcus epidermidis (strain ATCC 12228) GN=rpoC PE=3 SV=1 554 872 7.0E-13
sp|Q5HRK9|RPOC_STAEQ DNA-directed RNA polymerase subunit beta' OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=rpoC PE=3 SV=1 554 872 7.0E-13
sp|P0C1T4|RPOC_STAAU DNA-directed RNA polymerase subunit beta' (Fragment) OS=Staphylococcus aureus GN=rpoC PE=3 SV=1 562 872 9.0E-13
sp|A3DIZ5|RPOC_CLOTH DNA-directed RNA polymerase subunit beta' OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=rpoC PE=3 SV=1 562 872 1.0E-12
sp|P60286|RPOC_STAAW DNA-directed RNA polymerase subunit beta' OS=Staphylococcus aureus (strain MW2) GN=rpoC PE=3 SV=1 562 872 1.0E-12
sp|Q6GBU4|RPOC_STAAS DNA-directed RNA polymerase subunit beta' OS=Staphylococcus aureus (strain MSSA476) GN=rpoC PE=3 SV=1 562 872 1.0E-12
sp|P60285|RPOC_STAAN DNA-directed RNA polymerase subunit beta' OS=Staphylococcus aureus (strain N315) GN=rpoC PE=1 SV=1 562 872 1.0E-12
sp|P60284|RPOC_STAAM DNA-directed RNA polymerase subunit beta' OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=rpoC PE=3 SV=1 562 872 1.0E-12
sp|Q5HID2|RPOC_STAAC DNA-directed RNA polymerase subunit beta' OS=Staphylococcus aureus (strain COL) GN=rpoC PE=3 SV=1 562 872 1.0E-12
sp|Q2G0N5|RPOC_STAA8 DNA-directed RNA polymerase subunit beta' OS=Staphylococcus aureus (strain NCTC 8325) GN=rpoC PE=3 SV=2 562 872 1.0E-12
sp|Q6GJC5|RPOC_STAAR DNA-directed RNA polymerase subunit beta' OS=Staphylococcus aureus (strain MRSA252) GN=rpoC PE=3 SV=1 562 872 1.0E-12
sp|Q2YSB8|RPOC_STAAB DNA-directed RNA polymerase subunit beta' OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=rpoC PE=3 SV=1 562 872 1.0E-12
sp|Q2FJ97|RPOC_STAA3 DNA-directed RNA polymerase subunit beta' OS=Staphylococcus aureus (strain USA300) GN=rpoC PE=3 SV=2 562 872 2.0E-12
sp|Q49V53|RPOC_STAS1 DNA-directed RNA polymerase subunit beta' OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=rpoC PE=3 SV=1 621 872 2.0E-12
sp|Q8DS47|RPOC_STRMU DNA-directed RNA polymerase subunit beta' OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=rpoC PE=3 SV=2 561 872 3.0E-12
sp|B9DSZ6|RPOC_STRU0 DNA-directed RNA polymerase subunit beta' OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=rpoC PE=3 SV=1 555 872 3.0E-12
sp|A8AZI2|RPOC_STRGC DNA-directed RNA polymerase subunit beta' OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=rpoC PE=3 SV=1 560 872 3.0E-12
sp|A0QS66|RPOC_MYCS2 DNA-directed RNA polymerase subunit beta' OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=rpoC PE=1 SV=1 551 872 3.0E-12
sp|A4IJI2|RPOC_GEOTN DNA-directed RNA polymerase subunit beta' OS=Geobacillus thermodenitrificans (strain NG80-2) GN=rpoC PE=3 SV=2 561 872 3.0E-12
sp|A2RC52|RPOC_STRPG DNA-directed RNA polymerase subunit beta' OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=rpoC PE=3 SV=1 555 872 4.0E-12
sp|Q1JNX6|RPOC_STRPC DNA-directed RNA polymerase subunit beta' OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=rpoC PE=3 SV=1 555 872 5.0E-12
sp|Q1JE19|RPOC_STRPB DNA-directed RNA polymerase subunit beta' OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=rpoC PE=3 SV=1 555 872 5.0E-12
sp|Q48VR0|RPOC_STRPM DNA-directed RNA polymerase subunit beta' OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=rpoC PE=3 SV=1 555 872 5.0E-12
sp|Q1J8X0|RPOC_STRPF DNA-directed RNA polymerase subunit beta' OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=rpoC PE=3 SV=1 555 872 5.0E-12
sp|P0C0E0|RPOC_STRP1 DNA-directed RNA polymerase subunit beta' OS=Streptococcus pyogenes serotype M1 GN=rpoC PE=3 SV=1 555 872 5.0E-12
sp|Q1JJ22|RPOC_STRPD DNA-directed RNA polymerase subunit beta' OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=rpoC PE=3 SV=1 555 872 5.0E-12
sp|Q5XE96|RPOC_STRP6 DNA-directed RNA polymerase subunit beta' OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=rpoC PE=3 SV=1 555 872 5.0E-12
sp|C0M7R5|RPOC_STRE4 DNA-directed RNA polymerase subunit beta' OS=Streptococcus equi subsp. equi (strain 4047) GN=rpoC PE=3 SV=1 555 872 6.0E-12
sp|C0MEE4|RPOC_STRS7 DNA-directed RNA polymerase subunit beta' OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=rpoC PE=3 SV=1 555 872 6.0E-12
sp|Q8DNF1|RPOC_STRR6 DNA-directed RNA polymerase subunit beta' OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=rpoC PE=3 SV=1 560 872 6.0E-12
sp|P17545|RPB1B_TRYBB DNA-directed RNA polymerase II subunit RPB1-B OS=Trypanosoma brucei brucei GN=TRP5.9 PE=1 SV=1 1232 1358 1.0E-11
sp|A8MLD3|RPOC_ALKOO DNA-directed RNA polymerase subunit beta' OS=Alkaliphilus oremlandii (strain OhILAs) GN=rpoC PE=3 SV=1 562 872 1.0E-11
sp|A0JZ92|RPOC_ARTS2 DNA-directed RNA polymerase subunit beta' OS=Arthrobacter sp. (strain FB24) GN=rpoC PE=3 SV=1 560 891 1.0E-11
sp|P17546|RPB1A_TRYBB DNA-directed RNA polymerase II subunit RPB1-A OS=Trypanosoma brucei brucei GN=TRP4.8 PE=1 SV=1 1232 1358 2.0E-11
sp|C1CMQ7|RPOC_STRZP DNA-directed RNA polymerase subunit beta' OS=Streptococcus pneumoniae (strain P1031) GN=rpoC PE=3 SV=1 560 872 2.0E-11
sp|Q2JFI4|RPOC_FRASC DNA-directed RNA polymerase subunit beta' OS=Frankia sp. (strain CcI3) GN=rpoC PE=3 SV=1 551 882 3.0E-11
sp|O94666|RPC1_SCHPO DNA-directed RNA polymerase III subunit rpc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpc1 PE=2 SV=1 1184 1357 4.0E-11
sp|Q8SSC4|RPB1_ENCCU DNA-directed RNA polymerase II subunit RPB1 OS=Encephalitozoon cuniculi (strain GB-M1) GN=RPB1 PE=3 SV=1 1241 1355 4.0E-11
sp|A5N4P0|RPOC_CLOK5 DNA-directed RNA polymerase subunit beta' OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=rpoC PE=3 SV=1 516 872 6.0E-11
sp|B5E2F2|RPOC_STRP4 DNA-directed RNA polymerase subunit beta' OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=rpoC PE=3 SV=1 560 872 7.0E-11
sp|C1CTL3|RPOC_STRZT DNA-directed RNA polymerase subunit beta' OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=rpoC PE=3 SV=1 560 872 7.0E-11
sp|C1CGP3|RPOC_STRZJ DNA-directed RNA polymerase subunit beta' OS=Streptococcus pneumoniae (strain JJA) GN=rpoC PE=3 SV=1 560 872 7.0E-11
sp|B2IM39|RPOC_STRPS DNA-directed RNA polymerase subunit beta' OS=Streptococcus pneumoniae (strain CGSP14) GN=rpoC PE=3 SV=1 560 872 7.0E-11
sp|Q97NQ8|RPOC_STRPN DNA-directed RNA polymerase subunit beta' OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=rpoC PE=3 SV=1 560 872 7.0E-11
sp|B1I8R3|RPOC_STRPI DNA-directed RNA polymerase subunit beta' OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=rpoC PE=3 SV=1 560 872 7.0E-11
sp|C1CA05|RPOC_STRP7 DNA-directed RNA polymerase subunit beta' OS=Streptococcus pneumoniae (strain 70585) GN=rpoC PE=3 SV=1 560 872 7.0E-11
sp|B8ZNW6|RPOC_STRPJ DNA-directed RNA polymerase subunit beta' OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=rpoC PE=3 SV=1 560 872 8.0E-11
sp|Q04IK7|RPOC_STRP2 DNA-directed RNA polymerase subunit beta' OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=rpoC PE=3 SV=1 560 872 8.0E-11
sp|Q2RFP0|RPOC_MOOTA DNA-directed RNA polymerase subunit beta' OS=Moorella thermoacetica (strain ATCC 39073) GN=rpoC PE=3 SV=1 625 872 9.0E-11
sp|B0S2E5|RPOC_FINM2 DNA-directed RNA polymerase subunit beta' OS=Finegoldia magna (strain ATCC 29328) GN=rpoC PE=3 SV=2 621 872 1.0E-10
sp|P94892|RPOC_LEUMM DNA-directed RNA polymerase subunit beta' OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=rpoC PE=3 SV=2 548 872 1.0E-10
sp|O14802|RPC1_HUMAN DNA-directed RNA polymerase III subunit RPC1 OS=Homo sapiens GN=POLR3A PE=1 SV=2 1073 1357 2.0E-10
sp|A4IF62|RPC1_BOVIN DNA-directed RNA polymerase III subunit RPC1 OS=Bos taurus GN=POLR3A PE=2 SV=1 1073 1357 2.0E-10
sp|P25202|RPC1_GIAIN DNA-directed RNA polymerase III subunit RPC1 OS=Giardia intestinalis GN=RPOA3 PE=3 SV=1 1221 1355 2.0E-10
sp|Q1AU23|RPOC_RUBXD DNA-directed RNA polymerase subunit beta' OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=rpoC PE=3 SV=1 562 872 2.0E-10
sp|P94899|RPOC_LEUPS DNA-directed RNA polymerase subunit beta' (Fragment) OS=Leuconostoc pseudomesenteroides GN=rpoC PE=3 SV=1 548 872 4.0E-10
sp|Q04E86|RPOC_OENOB DNA-directed RNA polymerase subunit beta' OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=rpoC PE=3 SV=1 561 872 9.0E-10
sp|P08968|RPC1_TRYBB DNA-directed RNA polymerase III subunit RPC1 OS=Trypanosoma brucei brucei PE=3 SV=1 1234 1355 2.0E-09
sp|P27625|RPC1_PLAFA DNA-directed RNA polymerase III subunit RPC1 OS=Plasmodium falciparum PE=3 SV=1 1234 1364 2.0E-09
sp|P95405|RPOC_OENOE DNA-directed RNA polymerase subunit beta' (Fragment) OS=Oenococcus oeni GN=rpoC PE=3 SV=1 561 872 2.0E-09
sp|Q5ZL98|RPC1_CHICK DNA-directed RNA polymerase III subunit RPC1 OS=Gallus gallus GN=POLR3A PE=2 SV=1 1183 1357 3.0E-09
sp|F4JXF9|NRPC1_ARATH DNA-directed RNA polymerase III subunit 1 OS=Arabidopsis thaliana GN=NRPC1 PE=2 SV=1 1241 1357 4.0E-09
sp|B1MVW7|RPOC_LEUCK DNA-directed RNA polymerase subunit beta' OS=Leuconostoc citreum (strain KM20) GN=rpoC PE=3 SV=1 560 872 4.0E-09
sp|Q82DQ4|RPOC_STRAW DNA-directed RNA polymerase subunit beta' OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=rpoC PE=3 SV=1 817 961 4.0E-09
sp|Q6A6K7|RPOC_PROAC DNA-directed RNA polymerase subunit beta' OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=rpoC PE=3 SV=1 806 882 4.0E-09
sp|Q86AQ5|RPC1_DICDI DNA-directed RNA polymerase III subunit rpc1 OS=Dictyostelium discoideum GN=polr3a PE=3 SV=1 1184 1357 5.0E-09
sp|Q8CJT1|RPOC_STRCO DNA-directed RNA polymerase subunit beta' OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=rpoC PE=3 SV=1 817 891 7.0E-09
sp|A0LRL4|RPOC_ACIC1 DNA-directed RNA polymerase subunit beta' OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=rpoC PE=3 SV=1 824 899 9.0E-09
sp|P0C987|RPB1_ASFP4 Probable DNA-directed RNA polymerase subunit 1 homolog OS=African swine fever virus (isolate Tick/South Africa/Pretoriuskop Pr4/1996) GN=Pret-111 PE=3 SV=1 1232 1355 2.0E-08
sp|P0C988|RPB1_ASFWA Probable DNA-directed RNA polymerase subunit 1 homolog OS=African swine fever virus (isolate Warthog/Namibia/Wart80/1980) GN=War-109 PE=3 SV=1 1232 1355 2.0E-08
sp|P42486|RPB1_ASFB7 Probable DNA-directed RNA polymerase subunit 1 homolog OS=African swine fever virus (strain Badajoz 1971 Vero-adapted) GN=Ba71V-99 PE=3 SV=1 1232 1355 2.0E-08
sp|Q65215|RPB1_ASFM2 Probable DNA-directed RNA polymerase subunit 1 homolog OS=African swine fever virus (isolate Tick/Malawi/Lil 20-1/1983) GN=Mal-107 PE=3 SV=2 1232 1355 2.0E-08
sp|P0C989|RPB1_ASFK5 Probable DNA-directed RNA polymerase subunit 1 homolog OS=African swine fever virus (isolate Pig/Kenya/KEN-50/1950) GN=Ken-111 PE=3 SV=1 1232 1355 2.0E-08
sp|A9VP70|RPOC_BACWK DNA-directed RNA polymerase subunit beta' OS=Bacillus weihenstephanensis (strain KBAB4) GN=rpoC PE=3 SV=1 825 872 2.0E-08
sp|A7GK13|RPOC_BACCN DNA-directed RNA polymerase subunit beta' OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=rpoC PE=3 SV=1 825 872 2.0E-08
sp|B1W441|RPOC_STRGG DNA-directed RNA polymerase subunit beta' OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=rpoC PE=3 SV=1 824 891 3.0E-08
sp|A8M538|RPOC_SALAI DNA-directed RNA polymerase subunit beta' OS=Salinispora arenicola (strain CNS-205) GN=rpoC PE=3 SV=1 828 872 3.0E-08
sp|A4XBQ5|RPOC_SALTO DNA-directed RNA polymerase subunit beta' OS=Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / CNB-440) GN=rpoC PE=3 SV=1 828 872 3.0E-08
sp|B1VES2|RPOC_CORU7 DNA-directed RNA polymerase subunit beta' OS=Corynebacterium urealyticum (strain ATCC 43042 / DSM 7109) GN=rpoC PE=3 SV=1 621 882 3.0E-08
sp|Q5WLR9|RPOC_BACSK DNA-directed RNA polymerase subunit beta' OS=Bacillus clausii (strain KSM-K16) GN=rpoC PE=3 SV=1 825 872 4.0E-08
sp|A1SEK2|RPOC_NOCSJ DNA-directed RNA polymerase subunit beta' OS=Nocardioides sp. (strain BAA-499 / JS614) GN=rpoC PE=3 SV=1 824 882 4.0E-08
sp|C5C0K2|RPOC_BEUC1 DNA-directed RNA polymerase subunit beta' OS=Beutenbergia cavernae (strain ATCC BAA-8 / DSM 12333 / NBRC 16432) GN=rpoC PE=3 SV=1 824 892 5.0E-08
sp|Q67JT4|RPOC_SYMTH DNA-directed RNA polymerase subunit beta' OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=rpoC PE=3 SV=1 824 872 6.0E-08
sp|A6TWI9|RPOC_ALKMQ DNA-directed RNA polymerase subunit beta' OS=Alkaliphilus metalliredigens (strain QYMF) GN=rpoC PE=3 SV=1 820 872 9.0E-08
sp|P16355|RPA1_TRYBB DNA-directed RNA polymerase I subunit RPA1 OS=Trypanosoma brucei brucei GN=TRP11 PE=1 SV=1 1217 1365 1.0E-07
sp|Q196X0|RPB1_IIV3 Probable DNA-directed RNA polymerase II subunit RPB1 homolog OS=Invertebrate iridescent virus 3 GN=IIV3-090L PE=3 SV=1 1217 1354 1.0E-07
sp|Q9LQ02|NRPD1_ARATH DNA-directed RNA polymerase IV subunit 1 OS=Arabidopsis thaliana GN=NRPD1 PE=1 SV=1 1210 1355 1.0E-07
sp|B1IGG1|RPOC_CLOBK DNA-directed RNA polymerase subunit beta' OS=Clostridium botulinum (strain Okra / Type B1) GN=rpoC PE=3 SV=1 828 872 1.0E-07
sp|A7GJ81|RPOC_CLOBL DNA-directed RNA polymerase subunit beta' OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=rpoC PE=3 SV=1 828 872 1.0E-07
sp|Q0SQD7|RPOC_CLOPS DNA-directed RNA polymerase subunit beta' OS=Clostridium perfringens (strain SM101 / Type A) GN=rpoC PE=3 SV=1 828 872 1.0E-07
sp|P0C2E8|RPOC_CLOPE DNA-directed RNA polymerase subunit beta' OS=Clostridium perfringens (strain 13 / Type A) GN=rpoC PE=3 SV=1 828 872 1.0E-07
sp|Q0TMN9|RPOC_CLOP1 DNA-directed RNA polymerase subunit beta' OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=rpoC PE=3 SV=1 828 872 1.0E-07
sp|Q0RRS9|RPOC_FRAAA DNA-directed RNA polymerase subunit beta' OS=Frankia alni (strain ACN14a) GN=rpoC PE=3 SV=1 824 882 1.0E-07
sp|A8LC63|RPOC_FRASN DNA-directed RNA polymerase subunit beta' OS=Frankia sp. (strain EAN1pec) GN=rpoC PE=3 SV=1 824 907 1.0E-07
sp|B2GIK0|RPOC_KOCRD DNA-directed RNA polymerase subunit beta' OS=Kocuria rhizophila (strain ATCC 9341 / DSM 348 / NBRC 103217 / DC2201) GN=rpoC PE=3 SV=1 806 892 1.0E-07
sp|Q97EH0|RPOC_CLOAB DNA-directed RNA polymerase subunit beta' OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=rpoC PE=3 SV=1 828 872 1.0E-07
sp|B0K5G9|RPOC_THEPX DNA-directed RNA polymerase subunit beta' OS=Thermoanaerobacter sp. (strain X514) GN=rpoC PE=3 SV=2 824 872 1.0E-07
sp|B1KSN2|RPOC_CLOBM DNA-directed RNA polymerase subunit beta' OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=rpoC PE=3 SV=1 828 872 2.0E-07
sp|Q890N5|RPOC_CLOTE DNA-directed RNA polymerase subunit beta' OS=Clostridium tetani (strain Massachusetts / E88) GN=rpoC PE=3 SV=2 828 872 2.0E-07
sp|Q6F0L8|RPOC_MESFL DNA-directed RNA polymerase subunit beta' OS=Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1) GN=rpoC PE=3 SV=1 823 872 2.0E-07
sp|Q8R7U7|RPOC_CALS4 DNA-directed RNA polymerase subunit beta' OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=rpoC PE=3 SV=1 824 872 2.0E-07
sp|B0KCJ3|RPOC_THEP3 DNA-directed RNA polymerase subunit beta' OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=rpoC PE=3 SV=1 824 872 2.0E-07
sp|Q88XZ2|RPOC_LACPL DNA-directed RNA polymerase subunit beta' OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=rpoC PE=3 SV=1 825 872 3.0E-07
sp|Q6MRX5|RPOC_MYCMS DNA-directed RNA polymerase subunit beta' OS=Mycoplasma mycoides subsp. mycoides SC (strain PG1) GN=rpoC PE=3 SV=1 809 909 3.0E-07
sp|A0PXT9|RPOC_CLONN DNA-directed RNA polymerase subunit beta' OS=Clostridium novyi (strain NT) GN=rpoC PE=3 SV=1 828 872 3.0E-07
sp|Q2ST47|RPOC_MYCCT DNA-directed RNA polymerase subunit beta' OS=Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154) GN=rpoC PE=3 SV=1 809 909 3.0E-07
sp|Q04C21|RPOC_LACDB DNA-directed RNA polymerase subunit beta' OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=rpoC PE=3 SV=1 825 872 4.0E-07
sp|Q1GBM4|RPOC_LACDA DNA-directed RNA polymerase subunit beta' OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=rpoC PE=3 SV=1 825 872 5.0E-07
sp|P0DF32|RPOC_STRP3 DNA-directed RNA polymerase subunit beta' OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=rpoC PE=3 SV=1 825 872 6.0E-07
sp|Q8P2Y2|RPOC_STRP8 DNA-directed RNA polymerase subunit beta' OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=rpoC PE=3 SV=1 825 872 6.0E-07
sp|P0DF33|RPOC_STRPQ DNA-directed RNA polymerase subunit beta' OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=rpoC PE=3 SV=1 825 872 6.0E-07
sp|Q8G515|RPOC_BIFLO DNA-directed RNA polymerase subunit beta' OS=Bifidobacterium longum (strain NCC 2705) GN=rpoC PE=3 SV=1 824 910 6.0E-07
sp|B3DTE1|RPOC_BIFLD DNA-directed RNA polymerase subunit beta' OS=Bifidobacterium longum (strain DJO10A) GN=rpoC PE=3 SV=1 824 910 6.0E-07
sp|B8HD15|RPOC_ARTCA DNA-directed RNA polymerase subunit beta' OS=Arthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / JCM 12360 / NCIMB 13794 / A6) GN=rpoC PE=3 SV=1 817 891 7.0E-07
sp|A1R8V3|RPOC_ARTAT DNA-directed RNA polymerase subunit beta' OS=Arthrobacter aurescens (strain TC1) GN=rpoC PE=3 SV=1 817 891 7.0E-07
sp|A3CKD4|RPOC_STRSV DNA-directed RNA polymerase subunit beta' OS=Streptococcus sanguinis (strain SK36) GN=rpoC PE=3 SV=1 825 872 8.0E-07
sp|A9BF32|RPOC_PETMO DNA-directed RNA polymerase subunit beta' OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=rpoC PE=3 SV=1 824 878 8.0E-07
sp|A8YXJ9|RPOC_LACH4 DNA-directed RNA polymerase subunit beta' OS=Lactobacillus helveticus (strain DPC 4571) GN=rpoC PE=3 SV=1 825 872 9.0E-07
sp|A6W5T1|RPOC_KINRD DNA-directed RNA polymerase subunit beta' OS=Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216) GN=rpoC PE=3 SV=1 824 892 9.0E-07
sp|Q5FM96|RPOC_LACAC DNA-directed RNA polymerase subunit beta' OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=rpoC PE=3 SV=1 825 872 9.0E-07
sp|Q72HM6|RPOC_THET2 DNA-directed RNA polymerase subunit beta' OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=rpoC PE=3 SV=2 820 872 1.0E-06
sp|Q8RQE8|RPOC_THET8 DNA-directed RNA polymerase subunit beta' OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=rpoC PE=1 SV=1 820 872 1.0E-06
sp|Q820D6|RPOC_TROWT DNA-directed RNA polymerase subunit beta' OS=Tropheryma whipplei (strain Twist) GN=rpoC PE=3 SV=1 820 891 1.0E-06
sp|Q820D9|RPOC_TROW8 DNA-directed RNA polymerase subunit beta' OS=Tropheryma whipplei (strain TW08/27) GN=rpoC PE=3 SV=2 820 891 1.0E-06
sp|A6LKB7|RPOC_THEM4 DNA-directed RNA polymerase subunit beta' OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=rpoC PE=3 SV=1 828 882 1.0E-06
sp|A8F4G1|RPOC_PSELT DNA-directed RNA polymerase subunit beta' OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=rpoC PE=3 SV=1 828 882 1.0E-06
sp|Q17VN6|RPOBC_HELAH Bifunctional DNA-directed RNA polymerase subunit beta-beta' OS=Helicobacter acinonychis (strain Sheeba) GN=rpoBC PE=3 SV=1 773 860 2.0E-06
sp|A7HNY1|RPOC_FERNB DNA-directed RNA polymerase subunit beta' OS=Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) GN=rpoC PE=3 SV=1 828 878 2.0E-06
sp|B2G8Y5|RPOC_LACRJ DNA-directed RNA polymerase subunit beta' OS=Lactobacillus reuteri (strain JCM 1112) GN=rpoC PE=3 SV=1 825 872 2.0E-06
sp|A5VLL3|RPOC_LACRD DNA-directed RNA polymerase subunit beta' OS=Lactobacillus reuteri (strain DSM 20016) GN=rpoC PE=3 SV=1 825 872 2.0E-06
sp|Q7MA56|RPOBC_WOLSU Bifunctional DNA-directed RNA polymerase subunit beta-beta' OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=rpoBC PE=3 SV=1 770 860 2.0E-06
sp|B0K5G9|RPOC_THEPX DNA-directed RNA polymerase subunit beta' OS=Thermoanaerobacter sp. (strain X514) GN=rpoC PE=3 SV=2 416 692 2.0E-06
sp|O25806|RPOBC_HELPY Bifunctional DNA-directed RNA polymerase subunit beta-beta' OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=rpoBC PE=1 SV=1 773 860 3.0E-06
sp|Q1CS68|RPOBC_HELPH Bifunctional DNA-directed RNA polymerase subunit beta-beta' OS=Helicobacter pylori (strain HPAG1) GN=rpoBC PE=3 SV=1 773 860 3.0E-06
sp|B2UUV9|RPOBC_HELPS Bifunctional DNA-directed RNA polymerase subunit beta-beta' OS=Helicobacter pylori (strain Shi470) GN=rpoBC PE=3 SV=1 773 860 3.0E-06
sp|Q9ZK23|RPOBC_HELPJ Bifunctional DNA-directed RNA polymerase subunit beta-beta' OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=rpoBC PE=3 SV=1 773 860 3.0E-06
sp|P75271|RPOC_MYCPN DNA-directed RNA polymerase subunit beta' OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=rpoC PE=3 SV=1 824 872 3.0E-06
sp|B0KCJ3|RPOC_THEP3 DNA-directed RNA polymerase subunit beta' OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=rpoC PE=3 SV=1 416 692 3.0E-06
sp|Q38UQ3|RPOC_LACSS DNA-directed RNA polymerase subunit beta' OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=rpoC PE=3 SV=1 825 872 4.0E-06
sp|P77917|RPOC_PEDAC DNA-directed RNA polymerase subunit beta' (Fragment) OS=Pediococcus acidilactici GN=rpoC PE=3 SV=2 825 872 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006351 transcription, DNA-templated Yes
GO:0003677 DNA binding Yes
GO:0003899 DNA-directed 5'-3' RNA polymerase activity Yes
GO:0008152 metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0016740 transferase activity No
GO:1901576 organic substance biosynthetic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0097159 organic cyclic compound binding No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0034654 nucleobase-containing compound biosynthetic process No
GO:0097659 nucleic acid-templated transcription No
GO:0097747 RNA polymerase activity No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0034062 5'-3' RNA polymerase activity No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0009058 biosynthetic process No
GO:0009987 cellular process No
GO:0003824 catalytic activity No
GO:1901363 heterocyclic compound binding No
GO:0044238 primary metabolic process No
GO:0044237 cellular metabolic process No
GO:0019438 aromatic compound biosynthetic process No
GO:0016070 RNA metabolic process No
GO:0016779 nucleotidyltransferase activity No
GO:0071704 organic substance metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0003676 nucleic acid binding No
GO:0009059 macromolecule biosynthetic process No
GO:0005488 binding No
GO:0008150 biological_process No
GO:0046483 heterocycle metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0003674 molecular_function No
GO:0044249 cellular biosynthetic process No
GO:0018130 heterocycle biosynthetic process No
GO:0140098 catalytic activity, acting on RNA No
GO:0090304 nucleic acid metabolic process No
GO:0032774 RNA biosynthetic process No
GO:0006807 nitrogen compound metabolic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4918
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3324
Ophiocordyceps australis map64 (Brazil) OphauB2|2493
Ophiocordyceps camponoti-floridani Ophcf2|04276
Ophiocordyceps camponoti-rufipedis Ophun1|2094 (this protein)
Ophiocordyceps kimflemingae Ophio5|8157
Ophiocordyceps subramaniannii Hirsu2|1540

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2094
MFFISTILVPPNRFRPEARMGDSQITEAPQNRLFRSILSCCGRLAQALDADEESGDLTSQLNRAWSSLQLAVNGL
IDNSKTPKPLDPTKKVEDGIKQMLEKKEGLFRKNLMGKRVNFAARSVISPDPNLETNEIGVPPVFAKKLTYPEPV
TSHNFTEMQMAVINGLDKWPGAFAIENEHGQVVSLRNKSLEERSALANQLLAATNSNAAKTNNKKVYRHITNGDV
VLMNRQPTLHKPSIMGHRVRVLSAEKTLRMHYANCNTYNADFDGDEMNLHFPQNEAARAEALQIADTDHQYLSST
AGKPLRGLIQDHISLAVAMCSRDTFLSRGDYQQLIYAALRPESGHIAGERLQLLPPAIIKPTPRWTGKQVFSTIL
LNIRPPGCGHLSMLGATQIKAEQWGAKSEEGTVLFQDGYLVTGILDKSQIGSSSGGLVHAIHEIYGPAWAGKLLS
SLSRLLTRYLNMRAFSCGIDDLRLTKEGEVARRQALRAADEVGRQVASTYVSLGKHDDPSGSLLHDRLEEVFRDD
VKQKGLDLLMNRGATDITDAVLKVCIPNSLEKPFPRNQMQTMTTSGAKGSRVNASLITCNLGQQVLEGRRVPLMV
SGKSLPCFKPFETSVRAGGYVVNRFLTGISPQEYYFHHMAGREGLIDTAVKTSSSGYLQRCVIKGMEGLTVAYDN
SVRDSDGSLIQFLYGEDGLDVTKTKYLFDFGFVLQNAQSQHAQLSRDDKDGRILGDKHQQSQFTKYMKSAIKHAS
DRDRKDPLISKVNPATNAFATSESFFESMTNYLRDNADGLVKQKDKKSKQASSGGVVSRSAAQRLFAMKYLKSLA
EPGEAVGVIAGQSVGEPSTQMTLNTFHLAGHSAKNVTLGIPRLREILMTASRTIRTPSMTLYPVSELPMAKVEEF
VNSISVLRLDCIVDRVDIEERYGRGTKYEMAKMYRVRITFFPSKEYSETYSVTATNVLDTVERRLLPMICSLMKK
EIKARATNDTGDPREIEIGSRVAGILPASAVDDELDGTEAREKQNRTQAVSYGPNDAEDDAVQQQNERDAMSSED
GYDDLNDDVFRNQGAAVGESHDEDEDDEEKARLEEARLDKLTEKAAMDMIEQENRPEKVIIDDGLPAWEGAPDQS
KTIMEVIHENGSSASADSRSKRILQSHDEVTSFESDDKGGEWCSITLEYDFDVPKVLMLEIIRKSIRKTMIRQIP
GLGSCSLEVGDNGERMLHTVGVNLQAMHRYSDIIDIDRIQTNDIGAMLDVYGVEACRGNILRELTTVFESHGIKV
DNRHLNLIADYMTRGGGFISFDRRGLEGNVSPFTKMSFETTVAFLKDAVMSGDRDELVTPSSRLVMGRLGRIGTG
SFDVVTRLPMRRESMLA*
Coding >Ophun1|2094
ATGTTCTTCATATCGACGATTCTCGTTCCCCCCAATCGCTTCCGGCCAGAGGCACGAATGGGAGATTCTCAGATC
ACAGAGGCGCCACAGAACCGCCTCTTCAGATCGATATTGAGCTGCTGCGGGAGGCTGGCGCAGGCGCTCGACGCC
GATGAGGAATCGGGAGACCTAACTTCACAGCTGAATCGAGCATGGAGCAGTCTTCAGCTGGCAGTCAACGGCCTC
ATCGACAATTCCAAGACGCCGAAGCCCTTGGACCCTACGAAGAAGGTCGAGGACGGCATCAAGCAAATGCTGGAG
AAGAAGGAAGGACTTTTCAGGAAAAACCTGATGGGCAAACGAGTCAATTTCGCGGCCAGAAGCGTCATCTCACCA
GATCCCAATCTTGAGACGAATGAGATTGGGGTCCCGCCTGTTTTTGCAAAAAAACTCACGTACCCAGAGCCCGTC
ACCAGTCATAACTTCACAGAGATGCAAATGGCTGTCATCAATGGCCTTGATAAATGGCCTGGAGCTTTCGCCATC
GAAAACGAGCACGGGCAGGTTGTCAGTCTCCGAAACAAGTCGCTTGAGGAACGTTCGGCGCTCGCGAACCAGCTC
CTTGCGGCAACGAATAGCAATGCCGCCAAGACGAACAACAAGAAGGTCTACCGTCACATCACCAATGGAGACGTT
GTCTTGATGAACCGCCAGCCCACGCTGCACAAGCCGTCGATCATGGGCCATCGAGTCCGGGTTCTCTCCGCTGAG
AAGACCCTACGGATGCACTACGCTAACTGCAACACGTACAATGCCGACTTTGATGGAGATGAGATGAACTTGCAC
TTCCCACAAAACGAAGCTGCGAGAGCTGAGGCTTTGCAAATCGCCGATACAGATCACCAATATTTGTCGTCTACG
GCTGGCAAGCCTCTGAGGGGCTTGATCCAAGATCACATTTCACTGGCCGTGGCAATGTGCAGTCGGGATACCTTC
TTATCACGTGGTGACTACCAGCAGTTGATCTACGCTGCTCTGCGCCCCGAGAGCGGGCATATCGCGGGAGAACGG
CTACAGCTTCTACCTCCGGCCATCATCAAGCCCACGCCCAGGTGGACGGGCAAGCAAGTCTTCTCGACAATCCTG
CTCAATATTCGCCCACCCGGCTGCGGACACCTGAGCATGCTCGGAGCCACGCAGATCAAGGCGGAGCAATGGGGC
GCAAAGTCCGAGGAGGGCACTGTACTGTTCCAAGATGGCTATCTCGTCACTGGCATCCTTGACAAGTCTCAAATA
GGGAGCAGCTCCGGGGGACTTGTCCACGCCATTCACGAGATCTATGGTCCGGCGTGGGCAGGAAAGCTTCTGAGC
AGCCTCAGTCGATTGCTGACAAGATATCTGAACATGAGAGCATTCTCTTGCGGCATAGATGATCTCAGACTGACA
AAGGAGGGCGAGGTCGCGCGTCGACAAGCGCTGCGGGCTGCCGATGAGGTGGGCCGGCAAGTTGCCTCTACATAC
GTTTCATTGGGAAAACACGATGATCCTTCGGGCTCTTTACTGCATGACCGTCTCGAGGAGGTCTTTCGCGACGAT
GTCAAACAGAAGGGACTTGATCTTCTGATGAACCGCGGCGCAACCGACATCACAGATGCCGTTCTGAAAGTCTGC
ATCCCCAATAGTCTCGAAAAACCCTTTCCTCGCAATCAAATGCAAACGATGACGACGTCGGGAGCCAAGGGTTCG
AGGGTTAACGCCTCCCTCATTACTTGCAACCTTGGCCAACAAGTTTTGGAGGGCAGACGCGTCCCGCTCATGGTC
AGCGGCAAGTCTTTGCCATGCTTCAAGCCCTTTGAGACGAGCGTCAGAGCTGGAGGATACGTCGTGAATCGGTTT
CTCACCGGCATTAGTCCCCAGGAGTACTATTTCCATCACATGGCCGGGAGAGAAGGCCTGATTGACACAGCTGTC
AAGACCTCCAGTTCCGGATACCTGCAGAGATGTGTGATCAAGGGCATGGAAGGGCTCACGGTGGCCTATGACAAC
AGCGTCAGGGACTCGGATGGCTCCTTGATCCAGTTCTTGTACGGCGAAGACGGGCTTGACGTGACGAAGACAAAG
TATCTCTTTGACTTTGGCTTCGTTTTACAAAACGCTCAGTCTCAGCATGCCCAGCTTAGCCGAGACGACAAGGAC
GGCCGAATCCTTGGCGACAAACACCAACAGTCTCAATTCACCAAATACATGAAGAGCGCCATCAAGCACGCCTCG
GATCGTGACCGCAAGGACCCATTGATATCCAAGGTTAACCCGGCTACCAACGCTTTCGCCACGTCAGAGTCTTTT
TTCGAGTCCATGACAAATTACCTGAGGGACAACGCAGACGGACTAGTCAAGCAAAAGGATAAGAAATCGAAGCAA
GCGTCGTCTGGTGGCGTGGTGTCCCGAAGCGCTGCCCAGCGTCTGTTCGCCATGAAGTATCTGAAGTCGCTGGCA
GAACCTGGAGAGGCCGTTGGCGTCATCGCCGGACAATCCGTGGGCGAGCCTTCGACACAGATGACTTTGAACACC
TTCCATCTTGCTGGTCATTCGGCCAAGAATGTCACGTTGGGAATTCCCCGACTTCGCGAGATATTGATGACCGCC
TCAAGAACCATACGCACGCCTTCCATGACTCTCTACCCCGTCAGCGAGCTTCCTATGGCCAAAGTCGAAGAATTT
GTCAATTCCATCAGTGTACTGCGCCTGGATTGCATTGTGGATAGAGTTGACATCGAGGAAAGATATGGACGCGGG
ACGAAGTACGAAATGGCCAAGATGTACCGCGTGAGAATCACGTTCTTCCCATCAAAGGAGTACTCGGAGACCTAC
TCTGTCACAGCCACCAATGTTCTGGACACTGTTGAGAGGAGGCTTCTGCCGATGATTTGCTCTCTTATGAAAAAA
GAGATCAAGGCAAGGGCAACCAACGACACTGGGGATCCTCGTGAGATTGAGATCGGGAGCCGCGTAGCCGGCATA
TTACCTGCTTCAGCCGTGGACGATGAGCTTGACGGCACAGAGGCTAGGGAAAAACAAAACAGAACCCAAGCCGTT
TCCTATGGACCCAACGATGCCGAGGACGACGCGGTGCAACAACAGAATGAGAGAGATGCAATGAGCAGCGAGGAC
GGATATGACGATCTCAATGACGACGTGTTCCGAAATCAGGGAGCTGCGGTGGGCGAGAGTCACGACGAGGATGAA
GACGATGAAGAAAAAGCGCGGTTAGAAGAAGCGCGGTTAGACAAGCTCACCGAGAAAGCCGCTATGGATATGATT
GAGCAAGAGAACCGACCCGAGAAAGTCATTATTGACGATGGCCTGCCAGCGTGGGAGGGCGCACCAGACCAATCC
AAAACCATTATGGAGGTTATTCACGAGAATGGGTCATCAGCCTCGGCCGACTCTCGATCAAAGCGAATCTTGCAG
TCGCATGATGAAGTGACGTCTTTTGAGAGCGACGACAAAGGTGGAGAGTGGTGCAGCATCACGTTGGAGTACGAC
TTTGACGTCCCCAAGGTGCTGATGCTCGAGATTATCCGAAAGTCGATCCGCAAGACAATGATTCGGCAAATTCCT
GGCCTTGGATCTTGCAGTCTGGAAGTTGGTGACAATGGCGAACGAATGCTGCATACGGTAGGCGTCAATCTTCAG
GCCATGCATAGATACAGCGACATCATCGACATTGACCGGATCCAAACCAACGATATCGGAGCGATGCTCGATGTT
TACGGAGTGGAAGCGTGCCGAGGCAATATTCTGCGAGAGTTGACGACAGTCTTTGAATCCCATGGCATCAAGGTC
GATAACAGGCATCTCAACCTCATCGCCGACTATATGACGAGGGGAGGCGGCTTCATATCCTTCGACCGCAGAGGG
CTGGAAGGCAACGTCAGCCCGTTCACCAAGATGAGCTTTGAGACAACCGTTGCTTTTCTGAAGGATGCCGTGATG
AGCGGCGACAGGGATGAACTTGTGACGCCGAGCAGTCGGTTAGTCATGGGAAGGTTAGGAAGAATCGGCACGGGC
AGCTTCGATGTTGTTACTCGGTTGCCGATGCGTCGTGAGAGTATGTTGGCATAG
Transcript >Ophun1|2094
ATGTTCTTCATATCGACGATTCTCGTTCCCCCCAATCGCTTCCGGCCAGAGGCACGAATGGGAGATTCTCAGATC
ACAGAGGCGCCACAGAACCGCCTCTTCAGATCGATATTGAGCTGCTGCGGGAGGCTGGCGCAGGCGCTCGACGCC
GATGAGGAATCGGGAGACCTAACTTCACAGCTGAATCGAGCATGGAGCAGTCTTCAGCTGGCAGTCAACGGCCTC
ATCGACAATTCCAAGACGCCGAAGCCCTTGGACCCTACGAAGAAGGTCGAGGACGGCATCAAGCAAATGCTGGAG
AAGAAGGAAGGACTTTTCAGGAAAAACCTGATGGGCAAACGAGTCAATTTCGCGGCCAGAAGCGTCATCTCACCA
GATCCCAATCTTGAGACGAATGAGATTGGGGTCCCGCCTGTTTTTGCAAAAAAACTCACGTACCCAGAGCCCGTC
ACCAGTCATAACTTCACAGAGATGCAAATGGCTGTCATCAATGGCCTTGATAAATGGCCTGGAGCTTTCGCCATC
GAAAACGAGCACGGGCAGGTTGTCAGTCTCCGAAACAAGTCGCTTGAGGAACGTTCGGCGCTCGCGAACCAGCTC
CTTGCGGCAACGAATAGCAATGCCGCCAAGACGAACAACAAGAAGGTCTACCGTCACATCACCAATGGAGACGTT
GTCTTGATGAACCGCCAGCCCACGCTGCACAAGCCGTCGATCATGGGCCATCGAGTCCGGGTTCTCTCCGCTGAG
AAGACCCTACGGATGCACTACGCTAACTGCAACACGTACAATGCCGACTTTGATGGAGATGAGATGAACTTGCAC
TTCCCACAAAACGAAGCTGCGAGAGCTGAGGCTTTGCAAATCGCCGATACAGATCACCAATATTTGTCGTCTACG
GCTGGCAAGCCTCTGAGGGGCTTGATCCAAGATCACATTTCACTGGCCGTGGCAATGTGCAGTCGGGATACCTTC
TTATCACGTGGTGACTACCAGCAGTTGATCTACGCTGCTCTGCGCCCCGAGAGCGGGCATATCGCGGGAGAACGG
CTACAGCTTCTACCTCCGGCCATCATCAAGCCCACGCCCAGGTGGACGGGCAAGCAAGTCTTCTCGACAATCCTG
CTCAATATTCGCCCACCCGGCTGCGGACACCTGAGCATGCTCGGAGCCACGCAGATCAAGGCGGAGCAATGGGGC
GCAAAGTCCGAGGAGGGCACTGTACTGTTCCAAGATGGCTATCTCGTCACTGGCATCCTTGACAAGTCTCAAATA
GGGAGCAGCTCCGGGGGACTTGTCCACGCCATTCACGAGATCTATGGTCCGGCGTGGGCAGGAAAGCTTCTGAGC
AGCCTCAGTCGATTGCTGACAAGATATCTGAACATGAGAGCATTCTCTTGCGGCATAGATGATCTCAGACTGACA
AAGGAGGGCGAGGTCGCGCGTCGACAAGCGCTGCGGGCTGCCGATGAGGTGGGCCGGCAAGTTGCCTCTACATAC
GTTTCATTGGGAAAACACGATGATCCTTCGGGCTCTTTACTGCATGACCGTCTCGAGGAGGTCTTTCGCGACGAT
GTCAAACAGAAGGGACTTGATCTTCTGATGAACCGCGGCGCAACCGACATCACAGATGCCGTTCTGAAAGTCTGC
ATCCCCAATAGTCTCGAAAAACCCTTTCCTCGCAATCAAATGCAAACGATGACGACGTCGGGAGCCAAGGGTTCG
AGGGTTAACGCCTCCCTCATTACTTGCAACCTTGGCCAACAAGTTTTGGAGGGCAGACGCGTCCCGCTCATGGTC
AGCGGCAAGTCTTTGCCATGCTTCAAGCCCTTTGAGACGAGCGTCAGAGCTGGAGGATACGTCGTGAATCGGTTT
CTCACCGGCATTAGTCCCCAGGAGTACTATTTCCATCACATGGCCGGGAGAGAAGGCCTGATTGACACAGCTGTC
AAGACCTCCAGTTCCGGATACCTGCAGAGATGTGTGATCAAGGGCATGGAAGGGCTCACGGTGGCCTATGACAAC
AGCGTCAGGGACTCGGATGGCTCCTTGATCCAGTTCTTGTACGGCGAAGACGGGCTTGACGTGACGAAGACAAAG
TATCTCTTTGACTTTGGCTTCGTTTTACAAAACGCTCAGTCTCAGCATGCCCAGCTTAGCCGAGACGACAAGGAC
GGCCGAATCCTTGGCGACAAACACCAACAGTCTCAATTCACCAAATACATGAAGAGCGCCATCAAGCACGCCTCG
GATCGTGACCGCAAGGACCCATTGATATCCAAGGTTAACCCGGCTACCAACGCTTTCGCCACGTCAGAGTCTTTT
TTCGAGTCCATGACAAATTACCTGAGGGACAACGCAGACGGACTAGTCAAGCAAAAGGATAAGAAATCGAAGCAA
GCGTCGTCTGGTGGCGTGGTGTCCCGAAGCGCTGCCCAGCGTCTGTTCGCCATGAAGTATCTGAAGTCGCTGGCA
GAACCTGGAGAGGCCGTTGGCGTCATCGCCGGACAATCCGTGGGCGAGCCTTCGACACAGATGACTTTGAACACC
TTCCATCTTGCTGGTCATTCGGCCAAGAATGTCACGTTGGGAATTCCCCGACTTCGCGAGATATTGATGACCGCC
TCAAGAACCATACGCACGCCTTCCATGACTCTCTACCCCGTCAGCGAGCTTCCTATGGCCAAAGTCGAAGAATTT
GTCAATTCCATCAGTGTACTGCGCCTGGATTGCATTGTGGATAGAGTTGACATCGAGGAAAGATATGGACGCGGG
ACGAAGTACGAAATGGCCAAGATGTACCGCGTGAGAATCACGTTCTTCCCATCAAAGGAGTACTCGGAGACCTAC
TCTGTCACAGCCACCAATGTTCTGGACACTGTTGAGAGGAGGCTTCTGCCGATGATTTGCTCTCTTATGAAAAAA
GAGATCAAGGCAAGGGCAACCAACGACACTGGGGATCCTCGTGAGATTGAGATCGGGAGCCGCGTAGCCGGCATA
TTACCTGCTTCAGCCGTGGACGATGAGCTTGACGGCACAGAGGCTAGGGAAAAACAAAACAGAACCCAAGCCGTT
TCCTATGGACCCAACGATGCCGAGGACGACGCGGTGCAACAACAGAATGAGAGAGATGCAATGAGCAGCGAGGAC
GGATATGACGATCTCAATGACGACGTGTTCCGAAATCAGGGAGCTGCGGTGGGCGAGAGTCACGACGAGGATGAA
GACGATGAAGAAAAAGCGCGGTTAGAAGAAGCGCGGTTAGACAAGCTCACCGAGAAAGCCGCTATGGATATGATT
GAGCAAGAGAACCGACCCGAGAAAGTCATTATTGACGATGGCCTGCCAGCGTGGGAGGGCGCACCAGACCAATCC
AAAACCATTATGGAGGTTATTCACGAGAATGGGTCATCAGCCTCGGCCGACTCTCGATCAAAGCGAATCTTGCAG
TCGCATGATGAAGTGACGTCTTTTGAGAGCGACGACAAAGGTGGAGAGTGGTGCAGCATCACGTTGGAGTACGAC
TTTGACGTCCCCAAGGTGCTGATGCTCGAGATTATCCGAAAGTCGATCCGCAAGACAATGATTCGGCAAATTCCT
GGCCTTGGATCTTGCAGTCTGGAAGTTGGTGACAATGGCGAACGAATGCTGCATACGGTAGGCGTCAATCTTCAG
GCCATGCATAGATACAGCGACATCATCGACATTGACCGGATCCAAACCAACGATATCGGAGCGATGCTCGATGTT
TACGGAGTGGAAGCGTGCCGAGGCAATATTCTGCGAGAGTTGACGACAGTCTTTGAATCCCATGGCATCAAGGTC
GATAACAGGCATCTCAACCTCATCGCCGACTATATGACGAGGGGAGGCGGCTTCATATCCTTCGACCGCAGAGGG
CTGGAAGGCAACGTCAGCCCGTTCACCAAGATGAGCTTTGAGACAACCGTTGCTTTTCTGAAGGATGCCGTGATG
AGCGGCGACAGGGATGAACTTGTGACGCCGAGCAGTCGGTTAGTCATGGGAAGGTTAGGAAGAATCGGCACGGGC
AGCTTCGATGTTGTTACTCGGTTGCCGATGCGTCGTGAGAGTATGTTGGCATAG
Gene >Ophun1|2094
ATGTTCTTCATATCGACGATTCTCGTTCCCCCCAATCGCTTCCGGCCAGAGGCACGAATGGGAGATTCTCAGATC
ACAGAGGCGCCACAGAACCGCCTCTTCAGATCGATATTGAGCTGCTGCGGGAGGCTGGCGCAGGCGCTCGACGCC
GATGAGGAATCGGGAGACCTAACTTCACAGCTGAATCGAGCATGGAGCAGTCTTCAGCTGGCAGTCAACGGCCTC
ATCGACAATTCCAAGACGCCGAAGCCCTTGGACCCTACGAAGAAGGTCGAGGACGGCATCAAGCAAATGCTGGAG
AAGAAGGAAGGACTTTTCAGGAAAAACCTGATGGGCAAACGAGTCAATTTCGCGGCCAGAAGCGTCATCTCACCA
GATCCCAATCTTGAGACGAATGAGATTGGGGTCCCGCCTGTTTTTGCAAAAAAACTCACGTACCCAGAGCCCGTC
ACCAGTCATAACTTCACAGAGATGCAAATGGCTGTCATCAATGGCCTTGATAAATGGCCTGGAGCTTTCGCCATC
GAAAACGAGCACGGGCAGGTTGTCAGTCTCCGAAACAAGTCGCTTGAGGAACGTTCGGCGCTCGCGAACCAGCTC
CTTGCGGCAACGAATAGCAATGCCGCCAAGACGAACAACAAGAAGGTCTACCGTCACATCACCAATGGAGACGTT
GTCTTGATGAACCGCCAGCCCACGCTGCACAAGCCGTCGATCATGGGCCATCGAGTCCGGGTTCTCTCCGCTGAG
AAGACCCTACGGATGCACTACGCTAACTGCAACACGTACAATGCCGACTTTGATGGAGATGAGATGAACTTGCAC
TTCCCACAAAACGAAGCTGCGAGAGCTGAGGCTTTGCAAATCGCCGATACAGATCACCAATATTTGTCGTCTACG
GCTGGCAAGCCTCTGAGGGGCTTGATCCAAGATCACATTTCACTGGCCGTGGCAATGTGCAGTCGGGATACCTTC
TTATCACGTGGTGACTACCAGCAGTTGATCTACGCTGCTCTGCGCCCCGAGAGCGGGCATATCGCGGGAGAACGG
CTACAGCTTCTACCTCCGGCCATCATCAAGCCCACGCCCAGGTGGACGGGCAAGCAAGTCTTCTCGACAATCCTG
CTCAATATTCGCCCACCCGGCTGCGGACACCTGAGCATGCTCGGAGCCACGCAGATCAAGGCGGAGCAATGGGGC
GCAAAGTCCGAGGAGGGCACTGTACTGTTCCAAGATGGCTATCTCGTCACTGGCATCCTTGACAAGTCTCAAATA
GGGAGCAGCTCCGGGGGACTTGTCCACGCCATTCACGAGATCTATGGTCCGGCGTGGGCAGGAAAGCTTCTGAGC
AGCCTCAGTCGATTGCTGACAAGATATCTGAACATGAGAGCATTCTCTTGCGGCATAGATGATCTCAGACTGACA
AAGGAGGGCGAGGTCGCGCGTCGACAAGCGCTGCGGGCTGCCGATGAGGTGGGCCGGCAAGTTGCCTCTACATAC
GTTTCATTGGGAAAACACGATGATCCTTCGGGCTCTTTACTGCATGACCGTCTCGAGGAGGTCTTTCGCGACGAT
GTCAAACAGAAGGGACTTGATCTTCTGATGAACCGCGGCGCAACCGACATCACAGATGCCGTTCTGAAAGTCTGC
ATCCCCAATAGTCTCGAAAAACCCTTTCCTCGCAATCAAATGCAAACGATGACGACGTCGGGAGCCAAGGGTTCG
AGGGTTAACGCCTCCCTCATTACTTGCAACCTTGGCCAACAAGTTTTGGAGGGCAGACGCGTCCCGCTCATGGTC
AGCGGCAAGTCTTTGCCATGCTTCAAGCCCTTTGAGACGAGCGTCAGAGCTGGAGGATACGTCGTGAATCGGTTT
CTCACCGGCATTAGTCCCCAGGAGTACTATTTCCATCACATGGCCGGGAGAGAAGGCCTGATTGACACAGCTGTC
AAGACCTCCAGTTCCGGATACCTGCAGAGATGTGTGATCAAGGGCATGGAAGGGCTCACGGTGGCCTATGACAAC
AGCGTCAGGGACTCGGATGGCTCCTTGATCCAGTTCTTGTACGGCGAAGACGGGCTTGACGTGACGAAGACAAAG
TATCTCTTTGACTTTGGCTTCGTTTTACAAAACGCTCAGTCTCAGCATGCCCAGCTTAGCCGAGACGACAAGGAC
GGCCGAATCCTTGGCGACAAACACCAACAGTCTCAATTCACCAAATACATGAAGAGCGCCATCAAGCACGCCTCG
GATCGTGACCGCAAGGACCCATTGATATCCAAGGTTAACCCGGCTACCAACGCTTTCGCCACGTCAGAGTCTTTT
TTCGAGTCCATGACAAATTACCTGAGGGACAACGCAGACGGACTAGTCAAGCAAAAGGATAAGAAATCGAAGCAA
GCGTCGTCTGGTGGCGTGGTGTCCCGAAGCGCTGCCCAGCGTCTGTTCGCCATGAAGTATCTGAAGTCGCTGGCA
GAACCTGGAGAGGCCGTTGGCGTCATCGCCGGACAATCCGTGGGCGAGCCTTCGACACAGATGACTTTGAACACC
TTCCATCTTGCTGGTCATTCGGCCAAGAATGTCACGTTGGGAATTCCCCGACTTCGCGAGATATTGATGACCGCC
TCAAGAACCATACGCACGCCTTCCATGACTCTCTACCCCGTCAGCGAGCTTCCTATGGCCAAAGTCGAAGAATTT
GTCAATTCCATCAGTGTACTGCGCCTGGATTGCATTGTGGATAGAGTTGACATCGAGGAAAGATATGGACGCGGG
ACGAAGTACGAAATGGCCAAGATGTACCGCGTGAGAATCACGTTCTTCCCATCAAAGGAGTACTCGGAGACCTAC
TCTGTCACAGCCACCAATGTTCTGGACACTGTTGAGAGGAGGCTTCTGCCGATGATTTGCTCTCTTATGAAAAAA
GAGATCAAGGCAAGGGCAACCAACGACACTGGGGATCCTCGTGAGATTGAGATCGGGAGCCGCGTAGCCGGCATA
TTACCTGCTTCAGCCGTGGACGATGAGCTTGACGGCACAGAGGCTAGGGAAAAACAAAACAGAACCCAAGCCGTT
TCCTATGGACCCAACGATGCCGAGGACGACGCGGTGCAACAACAGAATGAGAGAGATGCAATGAGCAGCGAGGAC
GGATATGACGATCTCAATGACGACGTGTTCCGAAATCAGGGAGCTGCGGTGGGCGAGAGTCACGACGAGGATGAA
GACGATGAAGAAAAAGCGCGGTTAGAAGAAGCGCGGTTAGACAAGCTCACCGAGAAAGCCGCTATGGATATGATT
GAGCAAGAGAACCGACCCGAGAAAGTCATTATTGACGATGGCCTGCCAGCGTGGGAGGGCGCACCAGACCAATCC
AAAACCATTATGGAGGTTATTCACGAGAATGGGTCATCAGCCTCGGCCGACTCTCGATCAAAGCGAATCTTGCAG
TCGCATGATGAAGTGACGTCTTTTGAGAGCGACGACAAAGGTGGAGAGTGGTGCAGCATCACGTTGGAGTACGAC
TTTGACGTCCCCAAGGTGCTGATGCTCGAGATTATCCGAAAGTCGATCCGCAAGACAATGATTCGGCAAATTCCT
GGCCTTGGATCTTGCAGTCTGGAAGTTGGTGACAATGGCGAACGAATGCTGCATACGGTAGGCGTCAATCTTCAG
GCCATGCATAGATACAGCGACATCATCGACATTGACCGGATCCAAACCAACGATATCGGAGCGATGCTCGATGTT
TACGGAGTGGAAGCGTGCCGAGGCAATATTCTGCGAGAGTTGACGACAGTCTTTGAATCCCATGGCATCAAGGTC
GATAACAGGCATCTCAACCTCATCGCCGACTATATGACGAGGGGAGGCGGCTTCATATCCTTCGACCGCAGAGGG
CTGGAAGGCAACGTCAGCCCGTTCACCAAGATGAGCTTTGAGACAACCGTTGCTTTTCTGAAGGATGCCGTGATG
AGCGGCGACAGGGATGAACTTGTGACGCCGAGCAGTCGGTTAGTCATGGGAAGGTTAGGAAGAATCGGCACGGGC
AGCTTCGATGTTGTTACTCGGTTGCCGATGCGTCGTGAGAGTATGTTGGCATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail