Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2093
Gene name
LocationContig_2:11179..15932
Strand-
Gene length (bp)4753
Transcript length (bp)4698
Coding sequence length (bp)4698
Protein length (aa) 1566

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00275 EPSP_synthase EPSP synthase (3-phosphoshikimate 1-carboxyvinyltransferase) 7.9E-128 403 831
PF01761 DHQ_synthase 3-dehydroquinate synthase 3.5E-102 79 357
PF01487 DHquinase_I Type I 3-dehydroquinase 1.7E-53 1052 1271
PF01202 SKI Shikimate kinase 7.6E-35 867 1011
PF08501 Shikimate_dh_N Shikimate dehydrogenase substrate binding domain 9.0E-23 1285 1365
PF13685 Fe-ADH_2 Iron-containing alcohol dehydrogenase 1.4E-07 33 291
PF18317 SDH_C Shikimate 5'-dehydrogenase C-terminal domain 1.6E-07 1534 1563

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|C7YZ74|ARO1_NECH7 Pentafunctional AROM polypeptide OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=NECHADRAFT_47780 PE=3 SV=1 1 1563 0.0E+00
sp|B2B223|ARO1_PODAN Pentafunctional AROM polypeptide OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=PODANS_6_5280 PE=3 SV=1 9 1563 0.0E+00
sp|C9SE96|ARO1_VERA1 Pentafunctional AROM polypeptide OS=Verticillium alfalfae (strain VaMs.102 / ATCC MYA-4576 / FGSC 10136) GN=VDBG_03429 PE=3 SV=1 1 1563 0.0E+00
sp|D1ZA70|ARO1_SORMK Pentafunctional AROM polypeptide OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=SMAC_02366 PE=3 SV=1 8 1563 0.0E+00
sp|Q8X071|ARO1_NEUCR Pentafunctional AROM polypeptide OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=aro-1 PE=3 SV=1 8 1563 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|C7YZ74|ARO1_NECH7 Pentafunctional AROM polypeptide OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=NECHADRAFT_47780 PE=3 SV=1 1 1563 0.0E+00
sp|B2B223|ARO1_PODAN Pentafunctional AROM polypeptide OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=PODANS_6_5280 PE=3 SV=1 9 1563 0.0E+00
sp|C9SE96|ARO1_VERA1 Pentafunctional AROM polypeptide OS=Verticillium alfalfae (strain VaMs.102 / ATCC MYA-4576 / FGSC 10136) GN=VDBG_03429 PE=3 SV=1 1 1563 0.0E+00
sp|D1ZA70|ARO1_SORMK Pentafunctional AROM polypeptide OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=SMAC_02366 PE=3 SV=1 8 1563 0.0E+00
sp|Q8X071|ARO1_NEUCR Pentafunctional AROM polypeptide OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=aro-1 PE=3 SV=1 8 1563 0.0E+00
sp|A4RD09|ARO1_MAGO7 Pentafunctional AROM polypeptide OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MGG_01128 PE=3 SV=2 1 1563 0.0E+00
sp|A7F7H0|ARO1_SCLS1 Pentafunctional AROM polypeptide OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=SS1G_13550 PE=3 SV=1 4 1563 0.0E+00
sp|Q5XNP0|ARO1_SCLSC Pentafunctional AROM polypeptide OS=Sclerotinia sclerotiorum PE=3 SV=1 4 1549 0.0E+00
sp|C1FYJ9|ARO1_PARBD Pentafunctional AROM polypeptide OS=Paracoccidioides brasiliensis (strain Pb18) GN=PADG_00875 PE=3 SV=2 9 1563 0.0E+00
sp|C5PA86|ARO1_COCP7 Pentafunctional AROM polypeptide OS=Coccidioides posadasii (strain C735) GN=CPC735_008210 PE=3 SV=1 8 1563 0.0E+00
sp|C5G8R4|ARO1_AJEDR Pentafunctional AROM polypeptide OS=Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) GN=BDCG_01028 PE=3 SV=1 9 1563 0.0E+00
sp|C5JKE6|ARO1_AJEDS Pentafunctional AROM polypeptide OS=Ajellomyces dermatitidis (strain SLH14081) GN=BDBG_02999 PE=3 SV=1 9 1563 0.0E+00
sp|C4JYG6|ARO1_UNCRE Pentafunctional AROM polypeptide OS=Uncinocarpus reesii (strain UAMH 1704) GN=UREG_07217 PE=3 SV=1 8 1563 0.0E+00
sp|C0S433|ARO1_PARBP Pentafunctional AROM polypeptide OS=Paracoccidioides brasiliensis (strain Pb03) GN=PABG_02447 PE=3 SV=1 9 1563 0.0E+00
sp|C5FQ73|ARO1_ARTOC Pentafunctional AROM polypeptide OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=MCYG_04845 PE=3 SV=1 9 1563 0.0E+00
sp|C1H8L1|ARO1_PARBA Pentafunctional AROM polypeptide OS=Paracoccidioides lutzii (strain ATCC MYA-826 / Pb01) GN=PAAG_07102 PE=3 SV=2 9 1563 0.0E+00
sp|A1CP85|ARO1_ASPCL Pentafunctional AROM polypeptide OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=aroM PE=3 SV=1 9 1563 0.0E+00
sp|A1D244|ARO1_NEOFI Pentafunctional AROM polypeptide OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=aroM PE=3 SV=1 9 1563 0.0E+00
sp|C0NL63|ARO1_AJECG Pentafunctional AROM polypeptide OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=HCBG_03893 PE=3 SV=1 9 1563 0.0E+00
sp|C6HCG7|ARO1_AJECH Pentafunctional AROM polypeptide OS=Ajellomyces capsulatus (strain H143) GN=HCDG_03716 PE=3 SV=1 9 1563 0.0E+00
sp|B0XRM8|ARO1_ASPFC Pentafunctional AROM polypeptide OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=aroM PE=3 SV=1 9 1560 0.0E+00
sp|Q4WS76|ARO1_ASPFU Pentafunctional AROM polypeptide OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=aroM PE=3 SV=1 9 1560 0.0E+00
sp|B6QCA7|ARO12_TALMQ Pentafunctional AROM polypeptide 2 OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=aroM-2 PE=3 SV=1 9 1563 0.0E+00
sp|B6HAA7|ARO1_PENRW Pentafunctional AROM polypeptide OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=aroM PE=3 SV=1 9 1560 0.0E+00
sp|P07547|ARO1_EMENI Pentafunctional AROM polypeptide OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=aromA PE=1 SV=3 8 1560 0.0E+00
sp|B8N4Q9|ARO1_ASPFN Pentafunctional AROM polypeptide OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=aroM PE=3 SV=1 9 1563 0.0E+00
sp|B8M0U4|ARO1_TALSN Pentafunctional AROM polypeptide OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=aroM PE=3 SV=1 9 1563 0.0E+00
sp|B6QWH9|ARO11_TALMQ Pentafunctional AROM polypeptide 1 OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=aroM-1 PE=3 SV=1 9 1563 0.0E+00
sp|Q0D0F3|ARO1_ASPTN Pentafunctional AROM polypeptide OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=aroM PE=3 SV=1 9 1563 0.0E+00
sp|Q2UCP6|ARO1_ASPOR Pentafunctional AROM polypeptide OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=aroM PE=3 SV=1 9 1545 0.0E+00
sp|Q0V3H0|ARO1_PHANO Pentafunctional AROM polypeptide OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=SNOG_01444 PE=3 SV=2 9 1560 0.0E+00
sp|Q9P7R0|ARO1_SCHPO Pentafunctional AROM polypeptide OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=aro1 PE=3 SV=1 11 1563 0.0E+00
sp|Q6C1X5|ARO1_YARLI Pentafunctional AROM polypeptide OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ARO1 PE=3 SV=1 4 1563 0.0E+00
sp|B6JVD0|ARO1_SCHJY Pentafunctional AROM polypeptide OS=Schizosaccharomyces japonicus (strain yFS275 / FY16936) GN=aro1 PE=3 SV=1 5 1552 0.0E+00
sp|C4R4R8|ARO1_PICPG Pentafunctional AROM polypeptide OS=Komagataella pastoris (strain GS115 / ATCC 20864) GN=ARO1 PE=3 SV=1 10 1551 0.0E+00
sp|A5H2Q8|ARO11_LODEL Pentafunctional AROM polypeptide 1 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=ARO1-1 PE=3 SV=1 8 1551 0.0E+00
sp|A5H2P4|ARO12_LODEL Pentafunctional AROM polypeptide 2 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=ARO1-2 PE=3 SV=1 8 1551 0.0E+00
sp|B9WFG1|ARO1_CANDC Pentafunctional AROM polypeptide OS=Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) GN=ARO1 PE=3 SV=1 8 1563 0.0E+00
sp|C5DN02|ARO1_LACTC Pentafunctional AROM polypeptide OS=Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284) GN=ARO1 PE=3 SV=1 31 1563 0.0E+00
sp|Q5AME2|ARO1_CANAL Pentafunctional AROM polypeptide OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ARO1 PE=3 SV=1 8 1563 0.0E+00
sp|C5M1X2|ARO1_CANTT Pentafunctional AROM polypeptide OS=Candida tropicalis (strain ATCC MYA-3404 / T1) GN=ARO1 PE=3 SV=1 8 1563 0.0E+00
sp|Q8J294|ARO1_THACU Pentafunctional AROM polypeptide OS=Thanatephorus cucumeris PE=3 SV=1 12 1551 0.0E+00
sp|A3LSZ2|ARO1_PICST Pentafunctional AROM polypeptide OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=ARO1 PE=3 SV=2 8 1563 0.0E+00
sp|C4Y9D5|ARO1_CLAL4 Pentafunctional AROM polypeptide OS=Clavispora lusitaniae (strain ATCC 42720) GN=ARO1 PE=3 SV=1 10 1563 0.0E+00
sp|C7GIN5|ARO1_YEAS2 Pentafunctional AROM polypeptide OS=Saccharomyces cerevisiae (strain JAY291) GN=ARO1 PE=3 SV=1 12 1563 0.0E+00
sp|A6ZY89|ARO1_YEAS7 Pentafunctional AROM polypeptide OS=Saccharomyces cerevisiae (strain YJM789) GN=ARO1 PE=3 SV=1 12 1563 0.0E+00
sp|P08566|ARO1_YEAST Pentafunctional AROM polypeptide OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARO1 PE=1 SV=1 12 1552 0.0E+00
sp|B0D6H2|ARO1_LACBS Pentafunctional AROM polypeptide OS=Laccaria bicolor (strain S238N-H82 / ATCC MYA-4686) GN=LACBIDRAFT_233717 PE=3 SV=1 12 1551 0.0E+00
sp|C5DVG6|ARO1_ZYGRC Pentafunctional AROM polypeptide OS=Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) GN=ARO1 PE=3 SV=1 10 1551 0.0E+00
sp|Q6CJC4|ARO1_KLULA Pentafunctional AROM polypeptide OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ARO1 PE=3 SV=1 12 1563 0.0E+00
sp|C8Z543|ARO1_YEAS8 Pentafunctional AROM polypeptide OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=ARO1 PE=3 SV=1 12 1552 0.0E+00
sp|B3LGE9|ARO1_YEAS1 Pentafunctional AROM polypeptide OS=Saccharomyces cerevisiae (strain RM11-1a) GN=ARO1 PE=3 SV=1 12 1552 0.0E+00
sp|Q12659|ARO1_PNECA Pentafunctional AROM polypeptide OS=Pneumocystis carinii GN=arom PE=3 SV=1 12 1550 0.0E+00
sp|Q6FIV4|ARO1_CANGA Pentafunctional AROM polypeptide OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ARO1 PE=3 SV=1 12 1563 0.0E+00
sp|Q74ZZ1|ARO1_ASHGO Pentafunctional AROM polypeptide OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ARO1 PE=3 SV=2 10 1552 0.0E+00
sp|P0CM22|ARO1_CRYNJ Pentafunctional AROM polypeptide OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CNB01990 PE=3 SV=1 12 1563 0.0E+00
sp|P0CM23|ARO1_CRYNB Pentafunctional AROM polypeptide OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CNBB3730 PE=3 SV=1 12 1563 0.0E+00
sp|A8NMB4|ARO1_COPC7 Pentafunctional AROM polypeptide OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=CC1G_09809 PE=3 SV=2 12 1551 0.0E+00
sp|Q4P8F6|ARO1_USTMA Pentafunctional AROM polypeptide OS=Ustilago maydis (strain 521 / FGSC 9021) GN=UMAG_03607 PE=3 SV=1 24 1551 0.0E+00
sp|A8QCB2|ARO1_MALGO Pentafunctional AROM polypeptide OS=Malassezia globosa (strain ATCC MYA-4612 / CBS 7966) GN=MGL_3989 PE=3 SV=1 31 1554 0.0E+00
sp|A6R8Q8|ARO1_AJECN Pentafunctional AROM polypeptide OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=HCAG_06699 PE=3 SV=1 9 895 0.0E+00
sp|A6R8Q8|ARO1_AJECN Pentafunctional AROM polypeptide OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=HCAG_06699 PE=3 SV=1 971 1560 1.0E-170
sp|Q8RLV9|AROA_XENNA 3-phosphoshikimate 1-carboxyvinyltransferase OS=Xenorhabdus nematophila (strain ATCC 19061 / DSM 3370 / LMG 1036 / NCIB 9965 / AN6) GN=aroA PE=3 SV=1 404 833 2.0E-81
sp|B2VC79|AROA_ERWT9 3-phosphoshikimate 1-carboxyvinyltransferase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=aroA PE=3 SV=1 404 833 3.0E-81
sp|B7VM38|AROA_VIBTL 3-phosphoshikimate 1-carboxyvinyltransferase OS=Vibrio tasmaniensis (strain LGP32) GN=aroA PE=3 SV=1 408 831 1.0E-80
sp|A3QEC0|AROA_SHELP 3-phosphoshikimate 1-carboxyvinyltransferase OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=aroA PE=3 SV=1 404 828 2.0E-80
sp|Q2NUA9|AROA_SODGM 3-phosphoshikimate 1-carboxyvinyltransferase OS=Sodalis glossinidius (strain morsitans) GN=aroA PE=3 SV=1 404 832 1.0E-79
sp|Q6D401|AROA_PECAS 3-phosphoshikimate 1-carboxyvinyltransferase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=aroA PE=3 SV=1 404 833 1.0E-79
sp|B1JRD9|AROA_YERPY 3-phosphoshikimate 1-carboxyvinyltransferase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=aroA PE=3 SV=1 404 833 2.0E-79
sp|Q66CI8|AROA_YERPS 3-phosphoshikimate 1-carboxyvinyltransferase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=aroA PE=3 SV=1 404 833 2.0E-79
sp|B2KA23|AROA_YERPB 3-phosphoshikimate 1-carboxyvinyltransferase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=aroA PE=3 SV=1 404 833 2.0E-79
sp|A7FJW9|AROA_YERP3 3-phosphoshikimate 1-carboxyvinyltransferase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=aroA PE=3 SV=1 404 833 2.0E-79
sp|A4TN18|AROA_YERPP 3-phosphoshikimate 1-carboxyvinyltransferase OS=Yersinia pestis (strain Pestoides F) GN=aroA PE=3 SV=1 404 833 2.0E-79
sp|Q1CGG5|AROA_YERPN 3-phosphoshikimate 1-carboxyvinyltransferase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=aroA PE=3 SV=1 404 833 2.0E-79
sp|A9R7I2|AROA_YERPG 3-phosphoshikimate 1-carboxyvinyltransferase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=aroA PE=3 SV=1 404 833 2.0E-79
sp|Q60112|AROA_YERPE 3-phosphoshikimate 1-carboxyvinyltransferase OS=Yersinia pestis GN=aroA PE=3 SV=2 404 833 2.0E-79
sp|Q1CA73|AROA_YERPA 3-phosphoshikimate 1-carboxyvinyltransferase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=aroA PE=3 SV=1 404 833 2.0E-79
sp|C6DF65|AROA_PECCP 3-phosphoshikimate 1-carboxyvinyltransferase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=aroA PE=3 SV=1 404 833 3.0E-79
sp|A8GCH1|AROA_SERP5 3-phosphoshikimate 1-carboxyvinyltransferase OS=Serratia proteamaculans (strain 568) GN=aroA PE=3 SV=1 404 833 3.0E-79
sp|A1S6D3|AROA_SHEAM 3-phosphoshikimate 1-carboxyvinyltransferase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=aroA PE=3 SV=1 404 829 6.0E-79
sp|B8CMH2|AROA_SHEPW 3-phosphoshikimate 1-carboxyvinyltransferase OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=aroA PE=3 SV=1 404 828 8.0E-79
sp|Q93ED4|AROA_YERRU 3-phosphoshikimate 1-carboxyvinyltransferase OS=Yersinia ruckeri GN=aroA PE=3 SV=1 404 833 1.0E-78
sp|A6Q7Q0|AROA_SULNB 3-phosphoshikimate 1-carboxyvinyltransferase OS=Sulfurovum sp. (strain NBC37-1) GN=aroA PE=3 SV=1 404 831 2.0E-78
sp|P19688|AROA_YERE8 3-phosphoshikimate 1-carboxyvinyltransferase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=aroA PE=3 SV=2 404 833 5.0E-78
sp|A9MHX5|AROA_SALAR 3-phosphoshikimate 1-carboxyvinyltransferase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=aroA PE=3 SV=1 404 833 9.0E-78
sp|A8AIH5|AROA_CITK8 3-phosphoshikimate 1-carboxyvinyltransferase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=aroA PE=3 SV=1 404 833 1.0E-77
sp|A8H4A4|AROA_SHEPA 3-phosphoshikimate 1-carboxyvinyltransferase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=aroA PE=3 SV=1 404 829 2.0E-77
sp|Q7N6D5|AROA_PHOLL 3-phosphoshikimate 1-carboxyvinyltransferase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=aroA PE=3 SV=1 404 831 3.0E-77
sp|Q7MJ45|AROA_VIBVY 3-phosphoshikimate 1-carboxyvinyltransferase OS=Vibrio vulnificus (strain YJ016) GN=aroA PE=3 SV=1 404 831 3.0E-77
sp|Q04570|AROA_PASMU 3-phosphoshikimate 1-carboxyvinyltransferase OS=Pasteurella multocida (strain Pm70) GN=aroA PE=3 SV=2 404 831 3.0E-77
sp|A1RJF8|AROA_SHESW 3-phosphoshikimate 1-carboxyvinyltransferase OS=Shewanella sp. (strain W3-18-1) GN=aroA PE=3 SV=1 394 828 5.0E-77
sp|A8FVN6|AROA_SHESH 3-phosphoshikimate 1-carboxyvinyltransferase OS=Shewanella sediminis (strain HAW-EB3) GN=aroA PE=3 SV=1 404 829 6.0E-77
sp|Q87QX9|AROA_VIBPA 3-phosphoshikimate 1-carboxyvinyltransferase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=aroA PE=3 SV=1 404 831 7.0E-77
sp|A4Y732|AROA_SHEPC 3-phosphoshikimate 1-carboxyvinyltransferase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=aroA PE=3 SV=1 394 828 9.0E-77
sp|B0TT43|AROA_SHEHH 3-phosphoshikimate 1-carboxyvinyltransferase OS=Shewanella halifaxensis (strain HAW-EB4) GN=aroA PE=3 SV=1 404 829 9.0E-77
sp|Q8FJB6|AROA_ECOL6 3-phosphoshikimate 1-carboxyvinyltransferase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=aroA PE=3 SV=1 404 833 1.0E-76
sp|Q6LPE1|AROA_PHOPR 3-phosphoshikimate 1-carboxyvinyltransferase OS=Photobacterium profundum GN=aroA PE=3 SV=1 404 833 1.0E-76
sp|Q1RDV0|AROA_ECOUT 3-phosphoshikimate 1-carboxyvinyltransferase OS=Escherichia coli (strain UTI89 / UPEC) GN=aroA PE=3 SV=1 404 833 1.0E-76
sp|Q0TJE5|AROA_ECOL5 3-phosphoshikimate 1-carboxyvinyltransferase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=aroA PE=3 SV=1 404 833 1.0E-76
sp|A1A9I5|AROA_ECOK1 3-phosphoshikimate 1-carboxyvinyltransferase OS=Escherichia coli O1:K1 / APEC GN=aroA PE=3 SV=1 404 833 1.0E-76
sp|B7MS23|AROA_ECO81 3-phosphoshikimate 1-carboxyvinyltransferase OS=Escherichia coli O81 (strain ED1a) GN=aroA PE=3 SV=1 404 833 1.0E-76
sp|B7MHL7|AROA_ECO45 3-phosphoshikimate 1-carboxyvinyltransferase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=aroA PE=3 SV=1 404 833 1.0E-76
sp|B5XY87|AROA_KLEP3 3-phosphoshikimate 1-carboxyvinyltransferase OS=Klebsiella pneumoniae (strain 342) GN=aroA PE=3 SV=1 404 833 1.0E-76
sp|B4TRT9|AROA_SALSV 3-phosphoshikimate 1-carboxyvinyltransferase OS=Salmonella schwarzengrund (strain CVM19633) GN=aroA PE=3 SV=1 404 833 1.0E-76
sp|B4ET25|AROA_PROMH 3-phosphoshikimate 1-carboxyvinyltransferase OS=Proteus mirabilis (strain HI4320) GN=aroA PE=3 SV=1 403 831 1.0E-76
sp|C3LN54|AROA_VIBCM 3-phosphoshikimate 1-carboxyvinyltransferase OS=Vibrio cholerae serotype O1 (strain M66-2) GN=aroA PE=3 SV=1 404 836 2.0E-76
sp|Q9KRB0|AROA_VIBCH 3-phosphoshikimate 1-carboxyvinyltransferase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=aroA PE=1 SV=1 404 836 2.0E-76
sp|B4TD38|AROA_SALHS 3-phosphoshikimate 1-carboxyvinyltransferase OS=Salmonella heidelberg (strain SL476) GN=aroA PE=3 SV=1 404 833 2.0E-76
sp|B7UMZ4|AROA_ECO27 3-phosphoshikimate 1-carboxyvinyltransferase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=aroA PE=3 SV=1 404 833 2.0E-76
sp|P07637|AROA_SALTY 3-phosphoshikimate 1-carboxyvinyltransferase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=aroA PE=3 SV=2 404 833 2.0E-76
sp|A4W8S8|AROA_ENT38 3-phosphoshikimate 1-carboxyvinyltransferase OS=Enterobacter sp. (strain 638) GN=aroA PE=3 SV=1 404 833 2.0E-76
sp|C0PXU4|AROA_SALPC 3-phosphoshikimate 1-carboxyvinyltransferase OS=Salmonella paratyphi C (strain RKS4594) GN=aroA PE=3 SV=1 404 833 3.0E-76
sp|A9N7V6|AROA_SALPB 3-phosphoshikimate 1-carboxyvinyltransferase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=aroA PE=3 SV=1 404 833 3.0E-76
sp|Q57R23|AROA_SALCH 3-phosphoshikimate 1-carboxyvinyltransferase OS=Salmonella choleraesuis (strain SC-B67) GN=aroA PE=3 SV=1 404 833 3.0E-76
sp|P24497|AROA_KLEPN 3-phosphoshikimate 1-carboxyvinyltransferase OS=Klebsiella pneumoniae GN=aroA PE=3 SV=1 404 833 3.0E-76
sp|B1LJV6|AROA_ECOSM 3-phosphoshikimate 1-carboxyvinyltransferase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=aroA PE=3 SV=1 404 833 3.0E-76
sp|B7NM67|AROA_ECO7I 3-phosphoshikimate 1-carboxyvinyltransferase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=aroA PE=3 SV=1 404 833 3.0E-76
sp|P19786|AROA_SALTI 3-phosphoshikimate 1-carboxyvinyltransferase OS=Salmonella typhi GN=aroA PE=3 SV=2 404 833 3.0E-76
sp|C4K4D4|AROA_HAMD5 3-phosphoshikimate 1-carboxyvinyltransferase OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=aroA PE=3 SV=1 404 831 3.0E-76
sp|P59416|AROA_BUCBP 3-phosphoshikimate 1-carboxyvinyltransferase OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=aroA PE=3 SV=1 404 831 4.0E-76
sp|A7MES7|AROA_CROS8 3-phosphoshikimate 1-carboxyvinyltransferase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=aroA PE=3 SV=1 404 833 4.0E-76
sp|B5BBP9|AROA_SALPK 3-phosphoshikimate 1-carboxyvinyltransferase OS=Salmonella paratyphi A (strain AKU_12601) GN=aroA PE=3 SV=1 404 833 4.0E-76
sp|Q5PGG5|AROA_SALPA 3-phosphoshikimate 1-carboxyvinyltransferase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=aroA PE=3 SV=1 404 833 4.0E-76
sp|B7NAQ7|AROA_ECOLU 3-phosphoshikimate 1-carboxyvinyltransferase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=aroA PE=3 SV=1 404 833 5.0E-76
sp|B8EA95|AROA_SHEB2 3-phosphoshikimate 1-carboxyvinyltransferase OS=Shewanella baltica (strain OS223) GN=aroA PE=3 SV=1 394 828 5.0E-76
sp|P22299|AROA_SALGL 3-phosphoshikimate 1-carboxyvinyltransferase OS=Salmonella gallinarum GN=aroA PE=3 SV=1 404 833 7.0E-76
sp|B5R8J5|AROA_SALG2 3-phosphoshikimate 1-carboxyvinyltransferase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=aroA PE=3 SV=1 404 833 7.0E-76
sp|B5QYQ8|AROA_SALEP 3-phosphoshikimate 1-carboxyvinyltransferase OS=Salmonella enteritidis PT4 (strain P125109) GN=aroA PE=3 SV=1 404 833 7.0E-76
sp|B5FQ51|AROA_SALDC 3-phosphoshikimate 1-carboxyvinyltransferase OS=Salmonella dublin (strain CT_02021853) GN=aroA PE=3 SV=1 404 833 7.0E-76
sp|Q3Z3L4|AROA_SHISS 3-phosphoshikimate 1-carboxyvinyltransferase OS=Shigella sonnei (strain Ss046) GN=aroA PE=3 SV=1 404 833 8.0E-76
sp|Q31YU3|AROA_SHIBS 3-phosphoshikimate 1-carboxyvinyltransferase OS=Shigella boydii serotype 4 (strain Sb227) GN=aroA PE=3 SV=1 404 833 8.0E-76
sp|B2TUH3|AROA_SHIB3 3-phosphoshikimate 1-carboxyvinyltransferase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=aroA PE=3 SV=1 404 833 8.0E-76
sp|B6I8Y0|AROA_ECOSE 3-phosphoshikimate 1-carboxyvinyltransferase OS=Escherichia coli (strain SE11) GN=aroA PE=3 SV=1 404 833 8.0E-76
sp|P0A6D3|AROA_ECOLI 3-phosphoshikimate 1-carboxyvinyltransferase OS=Escherichia coli (strain K12) GN=aroA PE=1 SV=1 404 833 8.0E-76
sp|B1X848|AROA_ECODH 3-phosphoshikimate 1-carboxyvinyltransferase OS=Escherichia coli (strain K12 / DH10B) GN=aroA PE=3 SV=1 404 833 8.0E-76
sp|C4ZQ34|AROA_ECOBW 3-phosphoshikimate 1-carboxyvinyltransferase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=aroA PE=3 SV=1 404 833 8.0E-76
sp|B7M836|AROA_ECO8A 3-phosphoshikimate 1-carboxyvinyltransferase OS=Escherichia coli O8 (strain IAI1) GN=aroA PE=3 SV=1 404 833 8.0E-76
sp|B5YT42|AROA_ECO5E 3-phosphoshikimate 1-carboxyvinyltransferase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=aroA PE=3 SV=1 404 833 8.0E-76
sp|P0A6D4|AROA_ECO57 3-phosphoshikimate 1-carboxyvinyltransferase OS=Escherichia coli O157:H7 GN=aroA PE=3 SV=1 404 833 8.0E-76
sp|B7LDA0|AROA_ECO55 3-phosphoshikimate 1-carboxyvinyltransferase OS=Escherichia coli (strain 55989 / EAEC) GN=aroA PE=3 SV=1 404 833 8.0E-76
sp|A7ZJZ7|AROA_ECO24 3-phosphoshikimate 1-carboxyvinyltransferase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=aroA PE=3 SV=1 404 833 8.0E-76
sp|B4T142|AROA_SALNS 3-phosphoshikimate 1-carboxyvinyltransferase OS=Salmonella newport (strain SL254) GN=aroA PE=3 SV=1 404 833 8.0E-76
sp|B1IW23|AROA_ECOLC 3-phosphoshikimate 1-carboxyvinyltransferase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=aroA PE=3 SV=1 404 833 1.0E-75
sp|A7ZYL1|AROA_ECOHS 3-phosphoshikimate 1-carboxyvinyltransferase OS=Escherichia coli O9:H4 (strain HS) GN=aroA PE=3 SV=1 404 833 1.0E-75
sp|B6EIX8|AROA_ALISL 3-phosphoshikimate 1-carboxyvinyltransferase OS=Aliivibrio salmonicida (strain LFI1238) GN=aroA PE=3 SV=1 404 833 1.0E-75
sp|Q9ZFF7|AROA_SHISO 3-phosphoshikimate 1-carboxyvinyltransferase OS=Shigella sonnei GN=aroA PE=3 SV=1 404 833 1.0E-75
sp|A5F7G5|AROA_VIBC3 3-phosphoshikimate 1-carboxyvinyltransferase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=aroA PE=3 SV=1 408 836 1.0E-75
sp|B5F161|AROA_SALA4 3-phosphoshikimate 1-carboxyvinyltransferase OS=Salmonella agona (strain SL483) GN=aroA PE=3 SV=1 404 833 1.0E-75
sp|A6T701|AROA_KLEP7 3-phosphoshikimate 1-carboxyvinyltransferase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=aroA PE=3 SV=1 404 833 1.0E-75
sp|Q0HIX1|AROA_SHESM 3-phosphoshikimate 1-carboxyvinyltransferase OS=Shewanella sp. (strain MR-4) GN=aroA PE=3 SV=1 394 828 1.0E-75
sp|Q83RY8|AROA_SHIFL 3-phosphoshikimate 1-carboxyvinyltransferase OS=Shigella flexneri GN=aroA PE=3 SV=1 404 833 2.0E-75
sp|Q0SX08|AROA_SHIF8 3-phosphoshikimate 1-carboxyvinyltransferase OS=Shigella flexneri serotype 5b (strain 8401) GN=aroA PE=3 SV=1 404 833 2.0E-75
sp|B1KF47|AROA_SHEWM 3-phosphoshikimate 1-carboxyvinyltransferase OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=aroA PE=3 SV=1 404 829 2.0E-75
sp|Q32E25|AROA_SHIDS 3-phosphoshikimate 1-carboxyvinyltransferase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=aroA PE=3 SV=1 404 833 2.0E-75
sp|A3D4A6|AROA_SHEB5 3-phosphoshikimate 1-carboxyvinyltransferase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=aroA PE=3 SV=1 394 828 2.0E-75
sp|Q8VP65|AROA_PHODP 3-phosphoshikimate 1-carboxyvinyltransferase OS=Photobacterium damsela subsp. piscicida GN=aroA PE=3 SV=1 401 836 4.0E-75
sp|A0KWN7|AROA_SHESA 3-phosphoshikimate 1-carboxyvinyltransferase OS=Shewanella sp. (strain ANA-3) GN=aroA PE=3 SV=1 394 828 4.0E-75
sp|Q482G5|AROA_COLP3 3-phosphoshikimate 1-carboxyvinyltransferase OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=aroA PE=3 SV=1 411 833 5.0E-75
sp|Q8EEH8|AROA_SHEON 3-phosphoshikimate 1-carboxyvinyltransferase OS=Shewanella oneidensis (strain MR-1) GN=aroA PE=3 SV=1 394 828 6.0E-75
sp|B0UT47|AROA_HISS2 3-phosphoshikimate 1-carboxyvinyltransferase OS=Histophilus somni (strain 2336) GN=aroA PE=3 SV=1 404 828 1.0E-74
sp|Q7VR41|AROA_BLOFL 3-phosphoshikimate 1-carboxyvinyltransferase OS=Blochmannia floridanus GN=aroA PE=3 SV=1 404 829 2.0E-74
sp|O87006|AROA_SHIDY 3-phosphoshikimate 1-carboxyvinyltransferase OS=Shigella dysenteriae GN=aroA PE=3 SV=1 404 833 3.0E-74
sp|A9L2X7|AROA_SHEB9 3-phosphoshikimate 1-carboxyvinyltransferase OS=Shewanella baltica (strain OS195) GN=aroA PE=3 SV=1 394 828 3.0E-74
sp|Q0HV11|AROA_SHESR 3-phosphoshikimate 1-carboxyvinyltransferase OS=Shewanella sp. (strain MR-7) GN=aroA PE=3 SV=1 394 828 4.0E-74
sp|A6WNN0|AROA_SHEB8 3-phosphoshikimate 1-carboxyvinyltransferase OS=Shewanella baltica (strain OS185) GN=aroA PE=3 SV=1 394 828 5.0E-74
sp|Q0I320|AROA_HAES1 3-phosphoshikimate 1-carboxyvinyltransferase OS=Haemophilus somnus (strain 129Pt) GN=aroA PE=3 SV=1 404 828 8.0E-74
sp|P54220|AROA_MANHA 3-phosphoshikimate 1-carboxyvinyltransferase OS=Mannheimia haemolytica GN=aroA PE=3 SV=2 404 833 1.0E-73
sp|P52310|AROA_HISSO 3-phosphoshikimate 1-carboxyvinyltransferase OS=Histophilus somni GN=aroA PE=3 SV=1 404 828 1.0E-73
sp|Q7VLN9|AROA_HAEDU 3-phosphoshikimate 1-carboxyvinyltransferase OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=aroA PE=3 SV=1 404 836 1.0E-73
sp|Q12NE1|AROA_SHEDO 3-phosphoshikimate 1-carboxyvinyltransferase OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=aroA PE=3 SV=1 404 828 3.0E-73
sp|Q081U4|AROA_SHEFN 3-phosphoshikimate 1-carboxyvinyltransferase OS=Shewanella frigidimarina (strain NCIMB 400) GN=aroA PE=3 SV=1 404 833 3.0E-73
sp|B8D7K3|AROA_BUCAT 3-phosphoshikimate 1-carboxyvinyltransferase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=aroA PE=3 SV=1 403 828 3.0E-73
sp|P57396|AROA_BUCAI 3-phosphoshikimate 1-carboxyvinyltransferase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=aroA PE=3 SV=1 403 828 4.0E-73
sp|B8D9A1|AROA_BUCA5 3-phosphoshikimate 1-carboxyvinyltransferase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=aroA PE=3 SV=1 403 828 4.0E-73
sp|Q15T04|AROA_PSEA6 3-phosphoshikimate 1-carboxyvinyltransferase OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=aroA PE=3 SV=1 404 833 6.0E-73
sp|P05466|AROA_ARATH 3-phosphoshikimate 1-carboxyvinyltransferase, chloroplastic OS=Arabidopsis thaliana GN=At2g45300 PE=2 SV=3 411 831 7.0E-73
sp|A6VMU5|AROA_ACTSZ 3-phosphoshikimate 1-carboxyvinyltransferase OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=aroA PE=3 SV=1 404 833 9.0E-73
sp|Q9X4H2|AROA_EDWI9 3-phosphoshikimate 1-carboxyvinyltransferase OS=Edwardsiella ictaluri (strain 93-146) GN=aroA PE=3 SV=1 408 828 9.0E-73
sp|Q5E3Z0|AROA_VIBF1 3-phosphoshikimate 1-carboxyvinyltransferase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=aroA PE=3 SV=1 404 833 4.0E-72
sp|B5FG60|AROA_VIBFM 3-phosphoshikimate 1-carboxyvinyltransferase OS=Vibrio fischeri (strain MJ11) GN=aroA PE=3 SV=1 404 833 6.0E-72
sp|A7N1K3|AROA_VIBCB 3-phosphoshikimate 1-carboxyvinyltransferase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=aroA PE=3 SV=1 404 831 7.0E-72
sp|A6VXX9|AROA_MARMS 3-phosphoshikimate 1-carboxyvinyltransferase OS=Marinomonas sp. (strain MWYL1) GN=aroA PE=3 SV=1 411 829 1.0E-71
sp|Q3MAV9|AROA_ANAVT 3-phosphoshikimate 1-carboxyvinyltransferase OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=aroA PE=3 SV=1 398 828 2.0E-71
sp|Q65S78|AROA_MANSM 3-phosphoshikimate 1-carboxyvinyltransferase OS=Mannheimia succiniciproducens (strain MBEL55E) GN=aroA PE=3 SV=1 403 832 3.0E-71
sp|A5UJ35|AROA_HAEIG 3-phosphoshikimate 1-carboxyvinyltransferase OS=Haemophilus influenzae (strain PittGG) GN=aroA PE=3 SV=1 404 833 6.0E-71
sp|Q8YMB5|AROA_NOSS1 3-phosphoshikimate 1-carboxyvinyltransferase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=aroA PE=3 SV=1 398 828 9.0E-71
sp|A5UCH8|AROA_HAEIE 3-phosphoshikimate 1-carboxyvinyltransferase OS=Haemophilus influenzae (strain PittEE) GN=aroA PE=3 SV=1 404 828 9.0E-71
sp|Q4QL19|AROA_HAEI8 3-phosphoshikimate 1-carboxyvinyltransferase OS=Haemophilus influenzae (strain 86-028NP) GN=aroA PE=3 SV=1 404 828 9.0E-71
sp|Q1LTL1|AROA_BAUCH 3-phosphoshikimate 1-carboxyvinyltransferase OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=aroA PE=3 SV=1 404 831 1.0E-70
sp|Q82TD4|AROA_NITEU 3-phosphoshikimate 1-carboxyvinyltransferase OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=aroA PE=3 SV=1 405 831 2.0E-70
sp|A3N063|AROA_ACTP2 3-phosphoshikimate 1-carboxyvinyltransferase OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=aroA PE=3 SV=1 404 828 2.0E-70
sp|B0BNY1|AROA_ACTPJ 3-phosphoshikimate 1-carboxyvinyltransferase OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=aroA PE=3 SV=1 404 828 5.0E-70
sp|B3GXD4|AROA_ACTP7 3-phosphoshikimate 1-carboxyvinyltransferase OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=aroA PE=3 SV=1 404 828 5.0E-70
sp|Q492S6|AROA_BLOPB 3-phosphoshikimate 1-carboxyvinyltransferase OS=Blochmannia pennsylvanicus (strain BPEN) GN=aroA PE=3 SV=1 404 832 7.0E-70
sp|Q03421|AROA_HAEIN 3-phosphoshikimate 1-carboxyvinyltransferase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=aroA PE=3 SV=2 404 833 3.0E-69
sp|Q057N6|AROA_BUCCC 3-phosphoshikimate 1-carboxyvinyltransferase OS=Buchnera aphidicola subsp. Cinara cedri (strain Cc) GN=aroA PE=3 SV=1 404 828 4.0E-69
sp|A1STZ0|AROA_PSYIN 3-phosphoshikimate 1-carboxyvinyltransferase OS=Psychromonas ingrahamii (strain 37) GN=aroA PE=3 SV=1 408 831 6.0E-69
sp|B5EP40|AROB_ACIF5 3-dehydroquinate synthase OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=aroB PE=3 SV=1 20 371 1.0E-68
sp|B7J629|AROB_ACIF2 3-dehydroquinate synthase OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=aroB PE=3 SV=1 20 371 1.0E-68
sp|Q0AIZ5|AROA_NITEC 3-phosphoshikimate 1-carboxyvinyltransferase OS=Nitrosomonas eutropha (strain C91) GN=aroA PE=3 SV=1 411 832 1.0E-68
sp|B7K660|AROB_CYAP8 3-dehydroquinate synthase OS=Cyanothece sp. (strain PCC 8801) GN=aroB PE=3 SV=1 55 372 4.0E-68
sp|C1D543|AROA_LARHH 3-phosphoshikimate 1-carboxyvinyltransferase OS=Laribacter hongkongensis (strain HLHK9) GN=aroA PE=3 SV=1 403 831 4.0E-68
sp|Q3IJA2|AROB_PSEHT 3-dehydroquinate synthase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=aroB PE=3 SV=1 72 385 6.0E-68
sp|B5YHI4|AROB_THEYD 3-dehydroquinate synthase OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=aroB PE=3 SV=1 81 376 6.0E-68
sp|B2JF04|AROA_BURP8 3-phosphoshikimate 1-carboxyvinyltransferase OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=aroA PE=3 SV=1 405 833 4.0E-67
sp|Q8Y0Y6|AROA_RALSO 3-phosphoshikimate 1-carboxyvinyltransferase OS=Ralstonia solanacearum (strain GMI1000) GN=aroA PE=3 SV=1 405 828 5.0E-67
sp|B3H035|AROB_ACTP7 3-dehydroquinate synthase OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=aroB PE=3 SV=1 81 374 8.0E-67
sp|A3MYR5|AROB_ACTP2 3-dehydroquinate synthase OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=aroB PE=3 SV=1 81 374 8.0E-67
sp|Q59178|AROA_BUCAP 3-phosphoshikimate 1-carboxyvinyltransferase OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=aroA PE=3 SV=2 404 836 1.0E-66
sp|C4LB07|AROB_TOLAT 3-dehydroquinate synthase OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=aroB PE=3 SV=1 63 372 2.0E-66
sp|Q46Y50|AROA_CUPPJ 3-phosphoshikimate 1-carboxyvinyltransferase OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=aroA PE=3 SV=1 406 828 2.0E-66
sp|Q0KDH9|AROA_CUPNH 3-phosphoshikimate 1-carboxyvinyltransferase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=aroA PE=3 SV=1 405 831 3.0E-66
sp|Q74BL6|AROB_GEOSL 3-dehydroquinate synthase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=aroB PE=3 SV=1 35 328 4.0E-66
sp|A4SM13|AROA_AERS4 3-phosphoshikimate 1-carboxyvinyltransferase OS=Aeromonas salmonicida (strain A449) GN=aroA PE=3 SV=1 392 831 5.0E-66
sp|C4LEG3|AROA_TOLAT 3-phosphoshikimate 1-carboxyvinyltransferase OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=aroA PE=3 SV=1 404 828 6.0E-66
sp|B2J913|AROB_NOSP7 3-dehydroquinate synthase OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=aroB PE=3 SV=1 70 371 6.0E-66
sp|Q9L213|AROA2_STRCO 3-phosphoshikimate 1-carboxyvinyltransferase 2 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=aroA2 PE=3 SV=1 407 831 7.0E-66
sp|P17688|AROA_BRANA 3-phosphoshikimate 1-carboxyvinyltransferase, chloroplastic OS=Brassica napus PE=3 SV=1 411 831 1.0E-65
sp|B3R368|AROA_CUPTR 3-phosphoshikimate 1-carboxyvinyltransferase OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=aroA PE=3 SV=1 406 836 1.0E-65
sp|B2U886|AROA_RALPJ 3-phosphoshikimate 1-carboxyvinyltransferase OS=Ralstonia pickettii (strain 12J) GN=aroA PE=3 SV=1 405 828 1.0E-65
sp|Q0BJ01|AROB_BURCM 3-dehydroquinate synthase OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=aroB PE=3 SV=1 42 373 1.0E-65
sp|Q9JYU1|AROA_NEIMB 3-phosphoshikimate 1-carboxyvinyltransferase OS=Neisseria meningitidis serogroup B (strain MC58) GN=aroA PE=3 SV=1 406 832 2.0E-65
sp|Q3M4V2|AROB_ANAVT 3-dehydroquinate synthase OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=aroB PE=3 SV=1 60 371 3.0E-65
sp|A1KUN6|AROA_NEIMF 3-phosphoshikimate 1-carboxyvinyltransferase OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=aroA PE=3 SV=1 406 832 3.0E-65
sp|Q9JTT3|AROA_NEIMA 3-phosphoshikimate 1-carboxyvinyltransferase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=aroA PE=3 SV=1 406 832 3.0E-65
sp|Q2FQ54|AROA_METHJ 3-phosphoshikimate 1-carboxyvinyltransferase OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=aroA PE=3 SV=1 407 831 4.0E-65
sp|A9ADP0|AROB_BURM1 3-dehydroquinate synthase OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=aroB PE=3 SV=1 74 373 4.0E-65
sp|Q63Q57|AROB_BURPS 3-dehydroquinate synthase OS=Burkholderia pseudomallei (strain K96243) GN=aroB PE=3 SV=1 42 373 4.0E-65
sp|A3NED2|AROB_BURP6 3-dehydroquinate synthase OS=Burkholderia pseudomallei (strain 668) GN=aroB PE=3 SV=1 42 373 4.0E-65
sp|Q3JMW1|AROB_BURP1 3-dehydroquinate synthase OS=Burkholderia pseudomallei (strain 1710b) GN=aroB PE=3 SV=1 42 373 4.0E-65
sp|A3P066|AROB_BURP0 3-dehydroquinate synthase OS=Burkholderia pseudomallei (strain 1106a) GN=aroB PE=3 SV=1 42 373 4.0E-65
sp|A1V8D7|AROB_BURMS 3-dehydroquinate synthase OS=Burkholderia mallei (strain SAVP1) GN=aroB PE=3 SV=1 42 373 4.0E-65
sp|Q62GB0|AROB_BURMA 3-dehydroquinate synthase OS=Burkholderia mallei (strain ATCC 23344) GN=aroB PE=3 SV=1 42 373 4.0E-65
sp|A2S718|AROB_BURM9 3-dehydroquinate synthase OS=Burkholderia mallei (strain NCTC 10229) GN=aroB PE=3 SV=1 42 373 4.0E-65
sp|A3MPY1|AROB_BURM7 3-dehydroquinate synthase OS=Burkholderia mallei (strain NCTC 10247) GN=aroB PE=3 SV=1 42 373 4.0E-65
sp|Q8RB14|AROB_CALS4 3-dehydroquinate synthase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=aroB PE=3 SV=1 41 372 5.0E-65
sp|B2IYE4|AROA_NOSP7 3-phosphoshikimate 1-carboxyvinyltransferase OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=aroA PE=3 SV=1 398 833 5.0E-65
sp|B1YRS4|AROB_BURA4 3-dehydroquinate synthase OS=Burkholderia ambifaria (strain MC40-6) GN=aroB PE=3 SV=1 42 373 6.0E-65
sp|P23981|AROA1_TOBAC 3-phosphoshikimate 1-carboxyvinyltransferase 1, chloroplastic OS=Nicotiana tabacum GN=EPSPS-1 PE=2 SV=1 403 833 7.0E-65
sp|B1JU67|AROB_BURCC 3-dehydroquinate synthase OS=Burkholderia cenocepacia (strain MC0-3) GN=aroB PE=3 SV=1 42 373 7.0E-65
sp|A8G195|AROB_SHESH 3-dehydroquinate synthase OS=Shewanella sediminis (strain HAW-EB3) GN=aroB PE=3 SV=1 81 372 7.0E-65
sp|A4JAT5|AROB_BURVG 3-dehydroquinate synthase OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=aroB PE=3 SV=1 42 373 8.0E-65
sp|A3Q9D8|AROB_SHELP 3-dehydroquinate synthase OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=aroB PE=3 SV=1 27 372 8.0E-65
sp|A0K3S0|AROB_BURCH 3-dehydroquinate synthase OS=Burkholderia cenocepacia (strain HI2424) GN=aroB PE=3 SV=1 42 373 9.0E-65
sp|Q1BRZ3|AROB_BURCA 3-dehydroquinate synthase OS=Burkholderia cenocepacia (strain AU 1054) GN=aroB PE=3 SV=1 42 373 9.0E-65
sp|P73997|AROB_SYNY3 3-dehydroquinate synthase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=aroB PE=3 SV=1 29 390 1.0E-64
sp|B5E8I9|AROB_GEOBB 3-dehydroquinate synthase OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=aroB PE=3 SV=1 35 333 1.0E-64
sp|B4E603|AROB_BURCJ 3-dehydroquinate synthase OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=aroB PE=3 SV=1 42 373 2.0E-64
sp|B1WUD4|AROB_CYAA5 3-dehydroquinate synthase OS=Cyanothece sp. (strain ATCC 51142) GN=aroB PE=3 SV=1 38 374 2.0E-64
sp|Q5F889|AROA_NEIG1 3-phosphoshikimate 1-carboxyvinyltransferase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=aroA PE=3 SV=1 390 832 2.0E-64
sp|B0K0I7|AROB_THEPX 3-dehydroquinate synthase OS=Thermoanaerobacter sp. (strain X514) GN=aroB PE=3 SV=1 41 372 3.0E-64
sp|B1KP72|AROB_SHEWM 3-dehydroquinate synthase OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=aroB PE=3 SV=1 81 372 3.0E-64
sp|P11043|AROA_PETHY 3-phosphoshikimate 1-carboxyvinyltransferase, chloroplastic OS=Petunia hybrida PE=1 SV=1 404 833 3.0E-64
sp|B7KJH2|AROB_CYAP7 3-dehydroquinate synthase OS=Cyanothece sp. (strain PCC 7424) GN=aroB PE=3 SV=1 58 371 3.0E-64
sp|B3PJM0|AROA_CELJU 3-phosphoshikimate 1-carboxyvinyltransferase OS=Cellvibrio japonicus (strain Ueda107) GN=aroA PE=3 SV=1 411 833 3.0E-64
sp|Q8YVQ0|AROB_NOSS1 3-dehydroquinate synthase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=aroB PE=3 SV=1 75 371 4.0E-64
sp|C6E0S2|AROB_GEOSM 3-dehydroquinate synthase OS=Geobacter sp. (strain M21) GN=aroB PE=3 SV=1 35 333 4.0E-64
sp|Q3SK83|AROA_THIDA 3-phosphoshikimate 1-carboxyvinyltransferase OS=Thiobacillus denitrificans (strain ATCC 25259) GN=aroA PE=3 SV=1 407 836 4.0E-64
sp|Q39KC4|AROB_BURL3 3-dehydroquinate synthase OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=aroB PE=3 SV=1 42 373 4.0E-64
sp|B0K924|AROB_THEP3 3-dehydroquinate synthase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=aroB PE=3 SV=1 41 372 4.0E-64
sp|P10748|AROA_SOLLC 3-phosphoshikimate 1-carboxyvinyltransferase, chloroplastic OS=Solanum lycopersicum PE=2 SV=1 383 833 7.0E-64
sp|B4RL93|AROA_NEIG2 3-phosphoshikimate 1-carboxyvinyltransferase OS=Neisseria gonorrhoeae (strain NCCP11945) GN=aroA PE=3 SV=1 406 832 8.0E-64
sp|A3DDJ2|AROB_CLOTH 3-dehydroquinate synthase OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=aroB PE=3 SV=1 27 366 9.0E-64
sp|B4EB42|AROA_BURCJ 3-phosphoshikimate 1-carboxyvinyltransferase OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=aroA PE=3 SV=1 405 829 9.0E-64
sp|B0TL76|AROB_SHEHH 3-dehydroquinate synthase OS=Shewanella halifaxensis (strain HAW-EB4) GN=aroB PE=3 SV=1 27 372 1.0E-63
sp|A1RPQ6|AROB_SHESW 3-dehydroquinate synthase OS=Shewanella sp. (strain W3-18-1) GN=aroB PE=3 SV=1 27 372 1.0E-63
sp|B0CBS9|AROB_ACAM1 3-dehydroquinate synthase OS=Acaryochloris marina (strain MBIC 11017) GN=aroB PE=3 SV=1 71 328 1.0E-63
sp|B2T630|AROA_BURPP 3-phosphoshikimate 1-carboxyvinyltransferase OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=aroA PE=3 SV=1 406 832 1.0E-63
sp|B0JID6|AROB_MICAN 3-dehydroquinate synthase OS=Microcystis aeruginosa (strain NIES-843) GN=aroB PE=3 SV=1 58 372 1.0E-63
sp|Q1LI88|AROB_CUPMC 3-dehydroquinate synthase OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=aroB PE=3 SV=1 78 402 2.0E-63
sp|A9ADV6|AROA_BURM1 3-phosphoshikimate 1-carboxyvinyltransferase OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=aroA PE=3 SV=1 405 829 2.0E-63
sp|Q489N3|AROB_COLP3 3-dehydroquinate synthase OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=aroB PE=3 SV=1 53 373 2.0E-63
sp|B3R7B8|AROB_CUPTR 3-dehydroquinate synthase OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=aroB PE=3 SV=1 78 402 2.0E-63
sp|A4J3A3|AROB_DESRM 3-dehydroquinate synthase OS=Desulfotomaculum reducens (strain MI-1) GN=aroB PE=3 SV=1 45 328 2.0E-63
sp|B2UEG9|AROB_RALPJ 3-dehydroquinate synthase OS=Ralstonia pickettii (strain 12J) GN=aroB PE=3 SV=1 78 402 3.0E-63
sp|A4YBT0|AROB_SHEPC 3-dehydroquinate synthase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=aroB PE=3 SV=1 27 372 3.0E-63
sp|Q1BY28|AROA_BURCA 3-phosphoshikimate 1-carboxyvinyltransferase OS=Burkholderia cenocepacia (strain AU 1054) GN=aroA PE=3 SV=1 405 829 4.0E-63
sp|B1JXR9|AROA_BURCC 3-phosphoshikimate 1-carboxyvinyltransferase OS=Burkholderia cenocepacia (strain MC0-3) GN=aroA PE=3 SV=1 405 829 4.0E-63
sp|Q5QZ50|AROA_IDILO 3-phosphoshikimate 1-carboxyvinyltransferase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=aroA PE=3 SV=1 403 833 5.0E-63
sp|A4JCH4|AROA_BURVG 3-phosphoshikimate 1-carboxyvinyltransferase OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=aroA PE=3 SV=1 405 829 8.0E-63
sp|Q15Y44|AROB_PSEA6 3-dehydroquinate synthase OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=aroB PE=3 SV=1 45 371 8.0E-63
sp|Q088S6|AROB_SHEFN 3-dehydroquinate synthase OS=Shewanella frigidimarina (strain NCIMB 400) GN=aroB PE=3 SV=1 27 372 9.0E-63
sp|B8CNI9|AROB_SHEPW 3-dehydroquinate synthase OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=aroB PE=3 SV=1 81 372 9.0E-63
sp|Q46WJ4|AROB_CUPPJ 3-dehydroquinate synthase OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=aroB PE=3 SV=1 70 408 9.0E-63
sp|Q3ILA2|AROA_PSEHT 3-phosphoshikimate 1-carboxyvinyltransferase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=aroA PE=3 SV=1 404 831 1.0E-62
sp|A0K5M1|AROA_BURCH 3-phosphoshikimate 1-carboxyvinyltransferase OS=Burkholderia cenocepacia (strain HI2424) GN=aroA PE=3 SV=1 405 829 1.0E-62
sp|Q8DKS3|AROB_THEEB 3-dehydroquinate synthase OS=Thermosynechococcus elongatus (strain BP-1) GN=aroB PE=3 SV=2 71 371 1.0E-62
sp|Q8XV62|AROB_RALSO 3-dehydroquinate synthase OS=Ralstonia solanacearum (strain GMI1000) GN=aroB PE=3 SV=1 81 402 1.0E-62
sp|Q39IG1|AROA_BURL3 3-phosphoshikimate 1-carboxyvinyltransferase OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=aroA PE=3 SV=1 405 829 2.0E-62
sp|Q0HDV7|AROB_SHESM 3-dehydroquinate synthase OS=Shewanella sp. (strain MR-4) GN=aroB PE=3 SV=1 27 372 2.0E-62
sp|A1SRB7|AROB_PSYIN 3-dehydroquinate synthase OS=Psychromonas ingrahamii (strain 37) GN=aroB PE=3 SV=1 81 372 2.0E-62
sp|Q13VC2|AROA_BURXL 3-phosphoshikimate 1-carboxyvinyltransferase OS=Burkholderia xenovorans (strain LB400) GN=aroA PE=3 SV=1 406 829 2.0E-62
sp|Q0BH93|AROA_BURCM 3-phosphoshikimate 1-carboxyvinyltransferase OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=aroA PE=3 SV=1 405 829 2.0E-62
sp|B1YV33|AROA_BURA4 3-phosphoshikimate 1-carboxyvinyltransferase OS=Burkholderia ambifaria (strain MC40-6) GN=aroA PE=3 SV=1 405 829 3.0E-62
sp|A8GZ30|AROB_SHEPA 3-dehydroquinate synthase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=aroB PE=3 SV=1 81 372 3.0E-62
sp|Q82TB9|AROB_NITEU 3-dehydroquinate synthase OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=aroB PE=3 SV=1 35 372 3.0E-62
sp|Q9PDP5|AROB_XYLFA 3-dehydroquinate synthase OS=Xylella fastidiosa (strain 9a5c) GN=aroB PE=3 SV=1 75 414 3.0E-62
sp|Q0I052|AROB_SHESR 3-dehydroquinate synthase OS=Shewanella sp. (strain MR-7) GN=aroB PE=3 SV=1 27 372 5.0E-62
sp|Q3SLY4|AROB_THIDA 3-dehydroquinate synthase OS=Thiobacillus denitrificans (strain ATCC 25259) GN=aroB PE=3 SV=1 45 372 5.0E-62
sp|Q8EK19|AROB_SHEON 3-dehydroquinate synthase OS=Shewanella oneidensis (strain MR-1) GN=aroB PE=3 SV=1 27 372 5.0E-62
sp|Q39X04|AROB_GEOMG 3-dehydroquinate synthase OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=aroB PE=3 SV=1 77 328 5.0E-62
sp|A1SB13|AROB_SHEAM 3-dehydroquinate synthase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=aroB PE=3 SV=1 58 371 6.0E-62
sp|Q5N3D4|AROB_SYNP6 3-dehydroquinate synthase OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=aroB PE=3 SV=1 81 371 6.0E-62
sp|Q9KNV2|AROB_VIBCH 3-dehydroquinate synthase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=aroB PE=1 SV=2 27 373 7.0E-62
sp|A0L242|AROB_SHESA 3-dehydroquinate synthase OS=Shewanella sp. (strain ANA-3) GN=aroB PE=3 SV=1 45 372 8.0E-62
sp|B7VLJ6|AROB_VIBTL 3-dehydroquinate synthase OS=Vibrio tasmaniensis (strain LGP32) GN=aroB PE=3 SV=1 45 371 1.0E-61
sp|A5EXS0|AROB_DICNV 3-dehydroquinate synthase OS=Dichelobacter nodosus (strain VCS1703A) GN=aroB PE=3 SV=1 27 383 1.0E-61
sp|Q0K669|AROB_CUPNH 3-dehydroquinate synthase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=aroB PE=3 SV=1 78 402 1.0E-61
sp|Q4FQI3|AROB_PSYA2 3-dehydroquinate synthase OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=aroB PE=3 SV=1 81 372 1.0E-61
sp|Q1Q8Q9|AROB_PSYCK 3-dehydroquinate synthase OS=Psychrobacter cryohalolentis (strain K5) GN=aroB PE=3 SV=1 30 372 2.0E-61
sp|C1F548|AROB_ACIC5 3-dehydroquinate synthase OS=Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161) GN=aroB PE=3 SV=1 81 391 2.0E-61
sp|A9L694|AROB_SHEB9 3-dehydroquinate synthase OS=Shewanella baltica (strain OS195) GN=aroB PE=3 SV=1 81 372 2.0E-61
sp|Q7VNR5|AROB_HAEDU 3-dehydroquinate synthase OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=aroB PE=3 SV=1 27 374 3.0E-61
sp|B8EBF1|AROB_SHEB2 3-dehydroquinate synthase OS=Shewanella baltica (strain OS223) GN=aroB PE=3 SV=1 81 372 3.0E-61
sp|A1AQL5|AROB_PELPD 3-dehydroquinate synthase OS=Pelobacter propionicus (strain DSM 2379) GN=aroB PE=3 SV=1 71 325 4.0E-61
sp|B0UTE6|AROB_HISS2 3-dehydroquinate synthase OS=Histophilus somni (strain 2336) GN=aroB PE=3 SV=1 45 374 4.0E-61
sp|A4G861|AROA_HERAR 3-phosphoshikimate 1-carboxyvinyltransferase OS=Herminiimonas arsenicoxydans GN=aroA PE=3 SV=2 405 833 4.0E-61
sp|Q2YB61|AROB_NITMU 3-dehydroquinate synthase OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=aroB PE=3 SV=1 46 372 5.0E-61
sp|A6WTR1|AROB_SHEB8 3-dehydroquinate synthase OS=Shewanella baltica (strain OS185) GN=aroB PE=3 SV=1 81 372 5.0E-61
sp|B5ZS37|AROA_RHILW 3-phosphoshikimate 1-carboxyvinyltransferase OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=aroA PE=3 SV=1 396 831 6.0E-61
sp|Q7VT93|AROB_BORPE 3-dehydroquinate synthase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=aroB PE=3 SV=1 71 382 7.0E-61
sp|Q7W2B6|AROB_BORPA 3-dehydroquinate synthase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=aroB PE=3 SV=1 71 382 7.0E-61
sp|Q7WR84|AROB_BORBR 3-dehydroquinate synthase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=aroB PE=3 SV=1 71 382 7.0E-61
sp|Q0I432|AROB_HAES1 3-dehydroquinate synthase OS=Haemophilus somnus (strain 129Pt) GN=aroB PE=3 SV=1 45 374 8.0E-61
sp|A3DA14|AROB_SHEB5 3-dehydroquinate synthase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=aroB PE=3 SV=1 81 372 1.0E-60
sp|B6J3I1|AROB_COXB2 3-dehydroquinate synthase OS=Coxiella burnetii (strain CbuG_Q212) GN=aroB PE=3 SV=1 78 392 2.0E-60
sp|Q83AJ2|AROB_COXBU 3-dehydroquinate synthase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=aroB PE=3 SV=1 78 392 2.0E-60
sp|A9NB81|AROB_COXBR 3-dehydroquinate synthase OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=aroB PE=3 SV=1 78 392 2.0E-60
sp|B7N1G6|AROB_ECO81 3-dehydroquinate synthase OS=Escherichia coli O81 (strain ED1a) GN=aroB PE=3 SV=1 27 383 2.0E-60
sp|B6J4A4|AROB_COXB1 3-dehydroquinate synthase OS=Coxiella burnetii (strain CbuK_Q154) GN=aroB PE=3 SV=1 78 392 2.0E-60
sp|A1B1J4|AROB_PARDP 3-dehydroquinate synthase OS=Paracoccus denitrificans (strain Pd 1222) GN=aroB PE=3 SV=1 46 393 2.0E-60
sp|A3CV28|AROA_METMJ 3-phosphoshikimate 1-carboxyvinyltransferase OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=aroA PE=3 SV=1 394 831 3.0E-60
sp|Q9K9D5|AROA2_BACHD 3-phosphoshikimate 1-carboxyvinyltransferase 2 OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=aroA2 PE=3 SV=1 404 833 3.0E-60
sp|Q2KBU1|AROA_RHIEC 3-phosphoshikimate 1-carboxyvinyltransferase OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=aroA PE=3 SV=1 396 831 3.0E-60
sp|A8GKQ7|AROB_SERP5 3-dehydroquinate synthase OS=Serratia proteamaculans (strain 568) GN=aroB PE=3 SV=1 27 372 4.0E-60
sp|B0U6C7|AROB_XYLFM 3-dehydroquinate synthase OS=Xylella fastidiosa (strain M12) GN=aroB PE=3 SV=1 75 392 8.0E-60
sp|B1XKA0|AROB_SYNP2 3-dehydroquinate synthase OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=aroB PE=3 SV=1 78 372 8.0E-60
sp|Q0AJ12|AROB_NITEC 3-dehydroquinate synthase OS=Nitrosomonas eutropha (strain C91) GN=aroB PE=3 SV=1 40 372 8.0E-60
sp|Q2NH05|AROA_METST 3-phosphoshikimate 1-carboxyvinyltransferase OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=aroA PE=3 SV=1 404 831 1.0E-59
sp|Q65R35|AROB_MANSM 3-dehydroquinate synthase OS=Mannheimia succiniciproducens (strain MBEL55E) GN=aroB PE=3 SV=1 81 374 1.0E-59
sp|B3PRH7|AROA_RHIE6 3-phosphoshikimate 1-carboxyvinyltransferase OS=Rhizobium etli (strain CIAT 652) GN=aroA PE=3 SV=1 396 843 1.0E-59
sp|Q4QNY2|AROB_HAEI8 3-dehydroquinate synthase OS=Haemophilus influenzae (strain 86-028NP) GN=aroB PE=3 SV=1 81 397 1.0E-59
sp|B8GF70|AROA_METPE 3-phosphoshikimate 1-carboxyvinyltransferase OS=Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c) GN=aroA PE=3 SV=1 409 831 1.0E-59
sp|Q48N21|AROA_PSE14 3-phosphoshikimate 1-carboxyvinyltransferase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=aroA PE=3 SV=1 404 831 2.0E-59
sp|A5UAU8|AROB_HAEIE 3-dehydroquinate synthase OS=Haemophilus influenzae (strain PittEE) GN=aroB PE=3 SV=1 81 397 2.0E-59
sp|Q87DU9|AROB_XYLFT 3-dehydroquinate synthase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=aroB PE=3 SV=1 75 392 2.0E-59
sp|B2I9G0|AROB_XYLF2 3-dehydroquinate synthase OS=Xylella fastidiosa (strain M23) GN=aroB PE=3 SV=1 75 392 2.0E-59
sp|P43879|AROB_HAEIN 3-dehydroquinate synthase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=aroB PE=3 SV=1 81 397 2.0E-59
sp|A0LLU6|AROA_SYNFM 3-phosphoshikimate 1-carboxyvinyltransferase OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=aroA PE=3 SV=1 403 833 3.0E-59
sp|C5BGQ4|AROB_EDWI9 3-dehydroquinate synthase OS=Edwardsiella ictaluri (strain 93-146) GN=aroB PE=3 SV=1 45 371 3.0E-59
sp|Q21BX8|AROB_RHOPB 3-dehydroquinate synthase OS=Rhodopseudomonas palustris (strain BisB18) GN=aroB PE=3 SV=1 81 372 3.0E-59
sp|Q5P5P3|AROB_AROAE 3-dehydroquinate synthase OS=Aromatoleum aromaticum (strain EbN1) GN=aroB PE=3 SV=1 81 387 4.0E-59
sp|A6T1G3|AROA_JANMA 3-phosphoshikimate 1-carboxyvinyltransferase OS=Janthinobacterium sp. (strain Marseille) GN=aroA PE=3 SV=1 405 833 5.0E-59
sp|A7MSY2|AROB_VIBCB 3-dehydroquinate synthase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=aroB PE=3 SV=1 81 371 5.0E-59
sp|A9KBB1|AROB_COXBN 3-dehydroquinate synthase OS=Coxiella burnetii (strain Dugway 5J108-111) GN=aroB PE=3 SV=1 78 392 5.0E-59
sp|P12421|AROA_BORPE 3-phosphoshikimate 1-carboxyvinyltransferase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=aroA PE=3 SV=2 405 830 7.0E-59
sp|A5UG10|AROB_HAEIG 3-dehydroquinate synthase OS=Haemophilus influenzae (strain PittGG) GN=aroB PE=3 SV=1 81 397 1.0E-58
sp|Q4ZY26|AROA_PSEU2 3-phosphoshikimate 1-carboxyvinyltransferase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=aroA PE=3 SV=1 404 831 1.0E-58
sp|Q2RMW0|AROB_RHORT 3-dehydroquinate synthase OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=aroB PE=3 SV=1 81 373 1.0E-58
sp|P57924|AROB_PASMU 3-dehydroquinate synthase OS=Pasteurella multocida (strain Pm70) GN=aroB PE=3 SV=1 84 374 1.0E-58
sp|A5ETC5|AROB_BRASB 3-dehydroquinate synthase OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=aroB PE=3 SV=1 78 372 2.0E-58
sp|Q9RND7|AROA_BORBR 3-phosphoshikimate 1-carboxyvinyltransferase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=aroA PE=3 SV=2 405 830 2.0E-58
sp|Q7W602|AROA_BORPA 3-phosphoshikimate 1-carboxyvinyltransferase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=aroA PE=3 SV=1 405 830 2.0E-58
sp|C1D4Z4|AROB_LARHH 3-dehydroquinate synthase OS=Laribacter hongkongensis (strain HLHK9) GN=aroB PE=3 SV=1 81 395 3.0E-58
sp|B1JIQ4|AROB_YERPY 3-dehydroquinate synthase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=aroB PE=3 SV=1 10 382 3.0E-58
sp|Q664M0|AROB_YERPS 3-dehydroquinate synthase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=aroB PE=3 SV=1 10 382 3.0E-58
sp|A4TGU2|AROB_YERPP 3-dehydroquinate synthase OS=Yersinia pestis (strain Pestoides F) GN=aroB PE=3 SV=1 10 382 3.0E-58
sp|Q1CCP0|AROB_YERPN 3-dehydroquinate synthase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=aroB PE=3 SV=1 10 382 3.0E-58
sp|A9R4A9|AROB_YERPG 3-dehydroquinate synthase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=aroB PE=3 SV=1 10 382 3.0E-58
sp|Q8ZJF6|AROB_YERPE 3-dehydroquinate synthase OS=Yersinia pestis GN=aroB PE=3 SV=1 10 382 3.0E-58
sp|B2K5T4|AROB_YERPB 3-dehydroquinate synthase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=aroB PE=3 SV=1 10 382 3.0E-58
sp|Q1C2P3|AROB_YERPA 3-dehydroquinate synthase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=aroB PE=3 SV=1 10 382 3.0E-58
sp|A7FNT5|AROB_YERP3 3-dehydroquinate synthase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=aroB PE=3 SV=1 10 382 3.0E-58
sp|B3QAH7|AROB_RHOPT 3-dehydroquinate synthase OS=Rhodopseudomonas palustris (strain TIE-1) GN=aroB PE=3 SV=1 29 372 4.0E-58
sp|Q87L68|AROB_VIBPA 3-dehydroquinate synthase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=aroB PE=3 SV=1 28 371 4.0E-58
sp|A6VKZ5|AROB_ACTSZ 3-dehydroquinate synthase OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=aroB PE=3 SV=1 84 374 4.0E-58
sp|Q2NQJ2|AROB_SODGM 3-dehydroquinate synthase OS=Sodalis glossinidius (strain morsitans) GN=aroB PE=3 SV=1 27 383 5.0E-58
sp|Q6NCG9|AROB_RHOPA 3-dehydroquinate synthase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=aroB PE=3 SV=1 29 372 5.0E-58
sp|Q9A434|AROB_CAUCR 3-dehydroquinate synthase OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=aroB PE=3 SV=1 73 390 5.0E-58
sp|B8H332|AROB_CAUCN 3-dehydroquinate synthase OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=aroB PE=3 SV=1 73 390 5.0E-58
sp|Q8DUW2|AROB_STRMU 3-dehydroquinate synthase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=aroB PE=3 SV=1 46 379 6.0E-58
sp|B8HRK7|AROB_CYAP4 3-dehydroquinate synthase OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=aroB PE=3 SV=1 78 371 7.0E-58
sp|B4TY46|AROB_SALSV 3-dehydroquinate synthase OS=Salmonella schwarzengrund (strain CVM19633) GN=aroB PE=3 SV=1 27 383 7.0E-58
sp|A4VVS9|AROB_STRSY 3-dehydroquinate synthase OS=Streptococcus suis (strain 05ZYH33) GN=aroB PE=3 SV=1 46 372 7.0E-58
sp|A4W236|AROB_STRS2 3-dehydroquinate synthase OS=Streptococcus suis (strain 98HAH33) GN=aroB PE=3 SV=1 46 372 7.0E-58
sp|Q60BY2|AROB_METCA 3-dehydroquinate synthase OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=aroB PE=3 SV=1 63 395 9.0E-58
sp|A6Q3Y3|AROB_NITSB 3-dehydroquinate synthase OS=Nitratiruptor sp. (strain SB155-2) GN=aroB PE=3 SV=1 75 371 1.0E-57
sp|A6TL07|AROB_ALKMQ 3-dehydroquinate synthase OS=Alkaliphilus metalliredigens (strain QYMF) GN=aroB PE=3 SV=1 41 375 2.0E-57
sp|Q5QV59|AROB_IDILO 3-dehydroquinate synthase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=aroB PE=3 SV=1 72 372 2.0E-57
sp|P77980|AROB_SALTY 3-dehydroquinate synthase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=aroB PE=3 SV=1 27 383 2.0E-57
sp|B5R7M8|AROB_SALG2 3-dehydroquinate synthase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=aroB PE=3 SV=1 27 383 2.0E-57
sp|B5R2D5|AROB_SALEP 3-dehydroquinate synthase OS=Salmonella enteritidis PT4 (strain P125109) GN=aroB PE=3 SV=1 27 383 2.0E-57
sp|B5BH29|AROB_SALPK 3-dehydroquinate synthase OS=Salmonella paratyphi A (strain AKU_12601) GN=aroB PE=3 SV=1 27 383 2.0E-57
sp|C0Q0G1|AROB_SALPC 3-dehydroquinate synthase OS=Salmonella paratyphi C (strain RKS4594) GN=aroB PE=3 SV=1 27 383 2.0E-57
sp|A9MT55|AROB_SALPB 3-dehydroquinate synthase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=aroB PE=3 SV=1 27 383 2.0E-57
sp|Q5PLX2|AROB_SALPA 3-dehydroquinate synthase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=aroB PE=3 SV=1 27 383 2.0E-57
sp|B4SVI8|AROB_SALNS 3-dehydroquinate synthase OS=Salmonella newport (strain SL254) GN=aroB PE=3 SV=1 27 383 2.0E-57
sp|B4TKR2|AROB_SALHS 3-dehydroquinate synthase OS=Salmonella heidelberg (strain SL476) GN=aroB PE=3 SV=1 27 383 2.0E-57
sp|B5FJQ9|AROB_SALDC 3-dehydroquinate synthase OS=Salmonella dublin (strain CT_02021853) GN=aroB PE=3 SV=1 27 383 2.0E-57
sp|Q57IY8|AROB_SALCH 3-dehydroquinate synthase OS=Salmonella choleraesuis (strain SC-B67) GN=aroB PE=3 SV=1 27 383 2.0E-57
sp|B5F8K0|AROB_SALA4 3-dehydroquinate synthase OS=Salmonella agona (strain SL483) GN=aroB PE=3 SV=1 27 383 2.0E-57
sp|Q21H84|AROB_SACD2 3-dehydroquinate synthase OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=aroB PE=3 SV=1 41 356 3.0E-57
sp|Q03321|AROA_AERSA 3-phosphoshikimate 1-carboxyvinyltransferase OS=Aeromonas salmonicida GN=aroA PE=3 SV=4 392 831 3.0E-57
sp|A5GF05|AROB_GEOUR 3-dehydroquinate synthase OS=Geobacter uraniireducens (strain Rf4) GN=aroB PE=3 SV=1 81 333 3.0E-57
sp|Q7MH84|AROB_VIBVY 3-dehydroquinate synthase OS=Vibrio vulnificus (strain YJ016) GN=aroB PE=3 SV=1 45 371 4.0E-57
sp|Q38X86|AROB_LACSS 3-dehydroquinate synthase OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=aroB PE=3 SV=1 30 372 5.0E-57
sp|O50468|AROB_NEIGO 3-dehydroquinate synthase OS=Neisseria gonorrhoeae GN=aroB PE=3 SV=1 46 372 5.0E-57
sp|Q8DCM0|AROB_VIBVU 3-dehydroquinate synthase OS=Vibrio vulnificus (strain CMCP6) GN=aroB PE=3 SV=1 45 371 5.0E-57
sp|B4RQ17|AROB_NEIG2 3-dehydroquinate synthase OS=Neisseria gonorrhoeae (strain NCCP11945) GN=aroB PE=3 SV=1 46 372 5.0E-57
sp|Q5FAD4|AROB_NEIG1 3-dehydroquinate synthase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=aroB PE=3 SV=1 46 372 5.0E-57
sp|Q30RT3|AROB_SULDN 3-dehydroquinate synthase OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=aroB PE=3 SV=1 70 333 6.0E-57
sp|Q8K939|AROB_BUCAP 3-dehydroquinate synthase OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=aroB PE=3 SV=1 15 372 6.0E-57
sp|Q31BK2|AROB_PROM9 3-dehydroquinate synthase OS=Prochlorococcus marinus (strain MIT 9312) GN=aroB PE=3 SV=1 63 371 6.0E-57
sp|Q3ZZN1|AROB_DEHMC 3-dehydroquinate synthase OS=Dehalococcoides mccartyi (strain CBDB1) GN=aroB PE=3 SV=1 40 366 6.0E-57
sp|Q2L2S7|AROA_BORA1 3-phosphoshikimate 1-carboxyvinyltransferase OS=Bordetella avium (strain 197N) GN=aroA PE=3 SV=1 411 829 6.0E-57
sp|B8GPV3|AROB_THISH 3-dehydroquinate synthase OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=aroB PE=3 SV=1 81 372 7.0E-57
sp|Q07VC9|AROB_RHOP5 3-dehydroquinate synthase OS=Rhodopseudomonas palustris (strain BisA53) GN=aroB PE=3 SV=1 40 372 7.0E-57
sp|A6Q908|AROB_SULNB 3-dehydroquinate synthase OS=Sulfurovum sp. (strain NBC37-1) GN=aroB PE=3 SV=1 75 390 7.0E-57
sp|Q8Z205|AROB_SALTI 3-dehydroquinate synthase OS=Salmonella typhi GN=aroB PE=3 SV=1 27 383 8.0E-57
sp|Q5NFS1|AROB_FRATT 3-dehydroquinate synthase OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=aroB PE=3 SV=1 45 379 9.0E-57
sp|Q14H73|AROB_FRAT1 3-dehydroquinate synthase OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=aroB PE=3 SV=1 45 379 9.0E-57
sp|A5FRZ7|AROB_DEHMB 3-dehydroquinate synthase OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=aroB PE=3 SV=1 40 366 1.0E-56
sp|Q7NHM2|AROB_GLOVI 3-dehydroquinate synthase OS=Gloeobacter violaceus (strain PCC 7421) GN=aroB PE=3 SV=1 78 374 1.0E-56
sp|Q2A418|AROB_FRATH 3-dehydroquinate synthase OS=Francisella tularensis subsp. holarctica (strain LVS) GN=aroB PE=3 SV=1 45 379 1.0E-56
sp|A7NBH0|AROB_FRATF 3-dehydroquinate synthase OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=aroB PE=3 SV=1 45 379 1.0E-56
sp|B2SGC9|AROB_FRATM 3-dehydroquinate synthase OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=aroB PE=3 SV=1 45 379 2.0E-56
sp|Q3J2J0|AROB_RHOS4 3-dehydroquinate synthase OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=aroB PE=3 SV=1 46 373 2.0E-56
sp|Q5KXU5|AROB_GEOKA 3-dehydroquinate synthase OS=Geobacillus kaustophilus (strain HTA426) GN=aroB PE=3 SV=1 40 371 2.0E-56
sp|A0Q706|AROB_FRATN 3-dehydroquinate synthase OS=Francisella tularensis subsp. novicida (strain U112) GN=aroB PE=3 SV=1 45 379 2.0E-56
sp|A3PJS2|AROB_RHOS1 3-dehydroquinate synthase OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=aroB PE=3 SV=1 46 373 2.0E-56
sp|A2BQG2|AROB_PROMS 3-dehydroquinate synthase OS=Prochlorococcus marinus (strain AS9601) GN=aroB PE=3 SV=1 45 371 2.0E-56
sp|C6DGD4|AROB_PECCP 3-dehydroquinate synthase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=aroB PE=3 SV=1 45 382 3.0E-56
sp|A2BW03|AROB_PROM5 3-dehydroquinate synthase OS=Prochlorococcus marinus (strain MIT 9515) GN=aroB PE=3 SV=1 79 326 3.0E-56
sp|C1CEW4|AROB_STRZJ 3-dehydroquinate synthase OS=Streptococcus pneumoniae (strain JJA) GN=aroB PE=3 SV=1 45 371 3.0E-56
sp|B0T8F3|AROB_CAUSK 3-dehydroquinate synthase OS=Caulobacter sp. (strain K31) GN=aroB PE=3 SV=1 81 371 4.0E-56
sp|Q9JVW5|AROB_NEIMA 3-dehydroquinate synthase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=aroB PE=3 SV=1 46 382 4.0E-56
sp|A8G451|AROB_PROM2 3-dehydroquinate synthase OS=Prochlorococcus marinus (strain MIT 9215) GN=aroB PE=3 SV=1 45 371 5.0E-56
sp|Q7NA56|AROB_PHOLL 3-dehydroquinate synthase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=aroB PE=3 SV=1 10 372 5.0E-56
sp|A7I291|AROB_CAMHC 3-dehydroquinate synthase OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=aroB PE=3 SV=1 80 372 5.0E-56
sp|Q3Z988|AROB_DEHM1 3-dehydroquinate synthase OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=aroB PE=3 SV=1 34 366 5.0E-56
sp|Q7V209|AROB_PROMP 3-dehydroquinate synthase OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=aroB PE=3 SV=1 79 341 7.0E-56
sp|A7H333|AROB_CAMJD 3-dehydroquinate synthase OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=aroB PE=3 SV=1 70 372 7.0E-56
sp|Q8RU74|DHQS_SOLLC 3-dehydroquinate synthase, chloroplastic OS=Solanum lycopersicum GN=DHQS PE=2 SV=1 81 372 7.0E-56
sp|B4RG33|AROB_PHEZH 3-dehydroquinate synthase OS=Phenylobacterium zucineum (strain HLK1) GN=aroB PE=3 SV=1 81 377 8.0E-56
sp|A6W2T3|AROB_MARMS 3-dehydroquinate synthase OS=Marinomonas sp. (strain MWYL1) GN=aroB PE=3 SV=1 78 371 8.0E-56
sp|A4IYI9|AROB_FRATW 3-dehydroquinate synthase OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=aroB PE=3 SV=1 45 379 9.0E-56
sp|Q6F7E5|AROB_ACIAD 3-dehydroquinate synthase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=aroB PE=3 SV=1 45 356 1.0E-55
sp|A4IQ88|AROB_GEOTN 3-dehydroquinate synthase OS=Geobacillus thermodenitrificans (strain NG80-2) GN=aroB PE=3 SV=1 40 371 1.0E-55
sp|B9KSJ9|AROB_RHOSK 3-dehydroquinate synthase OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=aroB PE=3 SV=1 46 373 1.0E-55
sp|B0VQ34|AROB_ACIBS 3-dehydroquinate synthase OS=Acinetobacter baumannii (strain SDF) GN=aroB PE=3 SV=1 45 372 1.0E-55
sp|A3PC83|AROB_PROM0 3-dehydroquinate synthase OS=Prochlorococcus marinus (strain MIT 9301) GN=aroB PE=3 SV=1 45 371 1.0E-55
sp|Q89XW8|AROB_BRADU 3-dehydroquinate synthase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=aroB PE=3 SV=1 81 372 1.0E-55
sp|B0V8M9|AROB_ACIBY 3-dehydroquinate synthase OS=Acinetobacter baumannii (strain AYE) GN=aroB PE=3 SV=1 45 372 1.0E-55
sp|B7IAV6|AROB_ACIB5 3-dehydroquinate synthase OS=Acinetobacter baumannii (strain AB0057) GN=aroB PE=3 SV=1 45 372 1.0E-55
sp|B7GVP5|AROB_ACIB3 3-dehydroquinate synthase OS=Acinetobacter baumannii (strain AB307-0294) GN=aroB PE=3 SV=1 45 372 1.0E-55
sp|A3M9I8|AROB_ACIBT 3-dehydroquinate synthase OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=aroB PE=3 SV=2 45 372 1.0E-55
sp|B5E5N3|AROB_STRP4 3-dehydroquinate synthase OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=aroB PE=3 SV=1 45 371 2.0E-55
sp|Q12SL8|AROB_SHEDO 3-dehydroquinate synthase OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=aroB PE=3 SV=1 78 372 2.0E-55
sp|A1KS84|AROB_NEIMF 3-dehydroquinate synthase OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=aroB PE=3 SV=1 81 382 2.0E-55
sp|Q9JY01|AROB_NEIMB 3-dehydroquinate synthase OS=Neisseria meningitidis serogroup B (strain MC58) GN=aroB PE=3 SV=1 81 382 2.0E-55
sp|B2I0J2|AROB_ACIBC 3-dehydroquinate synthase OS=Acinetobacter baumannii (strain ACICU) GN=aroB PE=3 SV=1 45 372 3.0E-55
sp|Q28PF8|AROB_JANSC 3-dehydroquinate synthase OS=Jannaschia sp. (strain CCS1) GN=aroB PE=3 SV=1 81 394 3.0E-55
sp|Q03LH4|AROB_STRTD 3-dehydroquinate synthase OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=aroB PE=3 SV=1 46 382 3.0E-55
sp|Q0BMF4|AROB_FRATO 3-dehydroquinate synthase OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=aroB PE=3 SV=1 45 379 3.0E-55
sp|Q888I3|AROA_PSESM 3-phosphoshikimate 1-carboxyvinyltransferase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=aroA PE=3 SV=1 404 831 3.0E-55
sp|Q00784|QUTR_EMENI Quinate repressor protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=qutR PE=1 SV=2 860 1551 3.0E-55
sp|Q4JVG2|AROB_CORJK 3-dehydroquinate synthase OS=Corynebacterium jeikeium (strain K411) GN=aroB PE=3 SV=1 78 372 3.0E-55
sp|C1CQY0|AROB_STRZT 3-dehydroquinate synthase OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=aroB PE=3 SV=1 45 371 3.0E-55
sp|Q8DPD1|AROB_STRR6 3-dehydroquinate synthase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=aroB PE=3 SV=1 45 371 3.0E-55
sp|Q04JX2|AROB_STRP2 3-dehydroquinate synthase OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=aroB PE=3 SV=1 45 371 3.0E-55
sp|A8FM57|AROB_CAMJ8 3-dehydroquinate synthase OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=aroB PE=3 SV=1 70 372 3.0E-55
sp|Q7VBT3|AROB_PROMA 3-dehydroquinate synthase OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=aroB PE=3 SV=1 54 392 3.0E-55
sp|A7MKL4|AROB_CROS8 3-dehydroquinate synthase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=aroB PE=3 SV=1 27 383 4.0E-55
sp|C1CL84|AROB_STRZP 3-dehydroquinate synthase OS=Streptococcus pneumoniae (strain P1031) GN=aroB PE=3 SV=1 45 371 4.0E-55
sp|C1C7X6|AROB_STRP7 3-dehydroquinate synthase OS=Streptococcus pneumoniae (strain 70585) GN=aroB PE=3 SV=1 45 371 4.0E-55
sp|Q97Q56|AROB_STRPN 3-dehydroquinate synthase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=aroB PE=3 SV=1 45 371 4.0E-55
sp|A4WSQ8|AROB_RHOS5 3-dehydroquinate synthase OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=aroB PE=3 SV=1 80 377 4.0E-55
sp|B2IQJ3|AROB_STRPS 3-dehydroquinate synthase OS=Streptococcus pneumoniae (strain CGSP14) GN=aroB PE=3 SV=1 45 371 5.0E-55
sp|B1ICH6|AROB_STRPI 3-dehydroquinate synthase OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=aroB PE=3 SV=1 45 371 5.0E-55
sp|B8I359|AROB_CLOCE 3-dehydroquinate synthase OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=aroB PE=3 SV=1 45 390 5.0E-55
sp|Q31DP9|AROB_THICR 3-dehydroquinate synthase OS=Thiomicrospira crunogena (strain XCL-2) GN=aroB PE=3 SV=1 45 374 5.0E-55
sp|A9M1U4|AROB_NEIM0 3-dehydroquinate synthase OS=Neisseria meningitidis serogroup C (strain 053442) GN=aroB PE=3 SV=1 46 305 5.0E-55
sp|B1ZMW8|AROA_OPITP 3-phosphoshikimate 1-carboxyvinyltransferase OS=Opitutus terrae (strain DSM 11246 / PB90-1) GN=aroA PE=3 SV=1 404 840 5.0E-55
sp|Q5M556|AROB_STRT2 3-dehydroquinate synthase OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=aroB PE=3 SV=1 46 382 6.0E-55
sp|Q5M0M0|AROB_STRT1 3-dehydroquinate synthase OS=Streptococcus thermophilus (strain CNRZ 1066) GN=aroB PE=3 SV=1 46 382 6.0E-55
sp|Q1R5P8|AROB_ECOUT 3-dehydroquinate synthase OS=Escherichia coli (strain UTI89 / UPEC) GN=aroB PE=3 SV=1 27 383 7.0E-55
sp|B1LHI4|AROB_ECOSM 3-dehydroquinate synthase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=aroB PE=3 SV=1 27 383 7.0E-55
sp|B7NDZ3|AROB_ECOLU 3-dehydroquinate synthase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=aroB PE=3 SV=1 27 383 7.0E-55
sp|B1IP76|AROB_ECOLC 3-dehydroquinate synthase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=aroB PE=3 SV=1 27 383 7.0E-55
sp|Q8FCV7|AROB_ECOL6 3-dehydroquinate synthase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=aroB PE=3 SV=1 27 383 7.0E-55
sp|A1AGR6|AROB_ECOK1 3-dehydroquinate synthase OS=Escherichia coli O1:K1 / APEC GN=aroB PE=3 SV=1 27 383 7.0E-55
sp|B7NMF2|AROB_ECO7I 3-dehydroquinate synthase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=aroB PE=3 SV=1 27 383 7.0E-55
sp|B7MD00|AROB_ECO45 3-dehydroquinate synthase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=aroB PE=3 SV=1 27 383 7.0E-55
sp|B7UK94|AROB_ECO27 3-dehydroquinate synthase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=aroB PE=3 SV=1 27 383 7.0E-55
sp|O26860|AROA_METTH 3-phosphoshikimate 1-carboxyvinyltransferase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=aroA PE=3 SV=1 403 833 7.0E-55
sp|Q47JK6|AROB_DECAR 3-dehydroquinate synthase OS=Dechloromonas aromatica (strain RCB) GN=aroB PE=3 SV=1 45 372 7.0E-55
sp|Q7VHT1|AROB_HELHP 3-dehydroquinate synthase OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=aroB PE=3 SV=1 81 373 7.0E-55
sp|P31102|AROB_BACSU 3-dehydroquinate synthase OS=Bacillus subtilis (strain 168) GN=aroB PE=3 SV=1 38 379 8.0E-55
sp|Q32AK1|AROB_SHIDS 3-dehydroquinate synthase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=aroB PE=3 SV=1 27 383 8.0E-55
sp|B5YE18|AROB_DICT6 3-dehydroquinate synthase OS=Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12) GN=aroB PE=3 SV=1 46 372 9.0E-55
sp|A8A5J6|AROB_ECOHS 3-dehydroquinate synthase OS=Escherichia coli O9:H4 (strain HS) GN=aroB PE=3 SV=1 27 383 9.0E-55
[Show less]

GO

GO Term Description Terminal node
GO:0004764 shikimate 3-dehydrogenase (NADP+) activity Yes
GO:0016765 transferase activity, transferring alkyl or aryl (other than methyl) groups Yes
GO:0003855 3-dehydroquinate dehydratase activity Yes
GO:0016616 oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor No
GO:0016614 oxidoreductase activity, acting on CH-OH group of donors No
GO:0016835 carbon-oxygen lyase activity No
GO:0003674 molecular_function No
GO:0016740 transferase activity No
GO:0003824 catalytic activity No
GO:0016829 lyase activity No
GO:0016836 hydro-lyase activity No
GO:0016491 oxidoreductase activity No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 109 131 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1509
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5200
Ophiocordyceps australis map64 (Brazil) OphauB2|2489
Ophiocordyceps camponoti-floridani Ophcf2|04274
Ophiocordyceps camponoti-rufipedis Ophun1|2093 (this protein)
Ophiocordyceps kimflemingae Ophio5|8249
Ophiocordyceps subramaniannii Hirsu2|11167
Ophiocordyceps subramaniannii Hirsu2|2893

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2093
MAQFEDRSPETISILGEASIVADYALWPAAVAKDLCRNSPASTYVLITDTNLHDIYVPSFRDFFDSHRDKKATRQ
LLTYAVPPGEASKCRETKAEIEDWMLSQSCTRDTVLIALGGGVIGDMIGYVAATFMRGIRFVQVPTTLLAMVDSS
IGGKTAIDTPMGKNLVGAFWQPRRIYIDLDFLETLPPREFFNGMSEVIKTAAIWDEAEFAFLEQQAAHIVECARS
TAKNRLQPVKEAVKRIVVNAARVKADVVTRDEREGGLRNLLNFGHSIGHAIEAILAPQILHGEAVAIGMVKEAEL
ARFVGVLRPHAVARLSKCIASFGLPTSLHDKQVVKLTAGKQCQVEEMLQKMSVDKKNDGEQKKVVLLSAIGKTHE
NKASAVDDGSIKLILSSSVRVTPGVPPNLQATVTPPGSKSISNRALIMAALGSGRCRLKNLLHSDDTEYMLSAIT
RLRGASFSWQDAGEVLEVQGRAGQLQASKDDLYIGNAGTASRFLATVVALCQPADGVKHTILTGNDRMKTRPIGP
LVDALRSNGVDVEYLEQDKSLPLRIHAAGGFDGGLIELAATVSSQYVSSILMAAPYAKKPVTLRLVGGKPVSQPY
IDMTISMMLSFGLVVTRSDVETNTYHIPQGVYRNPPEYMIESDASSATYPLAVAAITGMTCVVPNIGFQSLQGDA
RFAVDVLRPMGCLVEQDEVSTKVTGPPVGTLRGLPHVDMEPMTDAFLTASVLAAVAQGTTQITGIANQRVKECNR
IKAMVDEISKFGVKCSELEDGIEIHGDSLTGMRSADAKIHCYDDHRVAMSLSVLAVASPGATIITQRECVGKTWP
GWWDTLTQSFRVTLAGIDETPDHQRTPADGDAERSIFVIGMRGAGKTTVGQWMAALLGWEFSDLDQELEKRSGKS
IIEMVSGSGQWEGFRQAELELLRDTMANQPLRHVFSCGGGVVETPQARDLLTAHCRRGGYVVLVHRSLDQIVDYL
KQDESRPAYASDVREVYQRRKLWYEQCSNYVYFSPHSGSSGSAGEIPDDLELFMASMRGSSGHLDSMATKGKSSF
FVSLTLPNLFKARELIPRVVDGADAVELRVDLLEDQSPEAVLEQVSILRSSARRPIIFTVRTQSQGGQFPDDAVG
ELQTLHRLALRVAVEYLDVEVTATDDTLQMVTDLRGHTQIIASHHDPLGNLAWKNASWIPFYNRALQYGNIIKLV
GTARTLEDNYHLASFKSRMLASQEIPIIAINMGSMGKLSRILNGFLTPVTHPDLPFPAAPGQLSATEIRQGLTLL
GQIDAQRFYLFGKPISQSKSPAIHNHLFRRMGLPHCYELRETDDVAQVEQVLQSAKFGGASVTIPLKRHVMSLVD
ELTPAAKIIGAINTIIPMAEADSSNRPRLLGDNTDWKGIVRTLRQSGASSHNNGACAMVVGSGGTTRAAVYALRS
MGYCPIYIIARDPSKALELAAGFPSDYNIQVVATHSEFVNKKACPRVIINTIPGDTPIDSKVKEILLAALETTEK
QPICRVLVEMAYKPRVTPVMELAGAAGGWRVIPGLEPLVSQGCYQFELWTGIIPSQDAAREAVGT*
Coding >Ophun1|2093
ATGGCGCAGTTCGAAGACCGTTCGCCGGAAACGATATCTATCCTGGGCGAAGCCAGCATTGTTGCCGACTACGCT
CTTTGGCCTGCCGCAGTCGCAAAAGACCTTTGCCGGAACTCACCAGCTTCCACATATGTTCTCATAACCGACACG
AATCTGCACGACATCTACGTGCCCTCTTTTCGGGATTTCTTCGACAGTCATCGGGACAAAAAGGCGACTCGTCAG
CTGTTGACGTACGCCGTGCCGCCCGGTGAGGCCTCAAAATGCCGCGAAACCAAGGCAGAGATCGAGGACTGGATG
CTGTCCCAAAGCTGCACGCGAGATACTGTCCTGATAGCTCTCGGTGGTGGAGTAATTGGTGATATGATTGGATAT
GTTGCTGCAACTTTCATGCGAGGCATTCGCTTCGTTCAGGTACCGACAACTTTGCTTGCCATGGTTGACTCGTCT
ATTGGAGGCAAGACCGCCATCGACACGCCCATGGGCAAGAACTTGGTTGGAGCCTTTTGGCAGCCGCGCCGCATT
TACATTGACCTGGATTTCTTAGAGACCCTTCCTCCACGCGAATTCTTCAATGGTATGTCGGAGGTCATCAAAACG
GCCGCCATTTGGGACGAAGCCGAGTTTGCTTTCCTGGAGCAACAAGCCGCACATATTGTAGAGTGTGCTCGTTCA
ACTGCTAAAAACCGTCTCCAGCCGGTTAAAGAAGCTGTGAAGCGAATTGTCGTCAACGCGGCACGTGTCAAAGCC
GACGTCGTCACCAGAGATGAGCGAGAAGGTGGCTTGCGCAATCTCCTCAATTTTGGACACTCCATCGGCCACGCA
ATAGAGGCCATCTTGGCCCCCCAGATTCTCCACGGCGAAGCGGTTGCTATCGGAATGGTCAAGGAAGCAGAATTG
GCCCGCTTCGTTGGAGTTCTCCGTCCCCATGCCGTGGCCAGACTCTCCAAATGCATTGCGTCGTTTGGGCTTCCT
ACATCATTGCACGACAAGCAGGTTGTCAAGTTAACTGCAGGCAAGCAGTGTCAAGTGGAGGAGATGCTGCAAAAG
ATGTCGGTCGACAAGAAGAACGACGGCGAACAGAAGAAGGTGGTGCTGTTATCTGCCATTGGCAAGACTCATGAA
AACAAAGCCAGTGCGGTGGATGATGGTTCCATCAAACTCATCCTAAGTTCCTCCGTCCGAGTCACACCTGGCGTG
CCTCCAAATTTGCAGGCCACCGTCACTCCGCCTGGTTCCAAGAGCATCTCCAACCGGGCGTTGATCATGGCGGCA
CTCGGATCCGGCCGCTGCCGCCTGAAAAACCTGCTTCACTCTGACGACACAGAGTACATGCTATCCGCCATTACG
CGTCTTCGTGGCGCATCTTTCTCTTGGCAAGACGCTGGTGAGGTGCTCGAAGTTCAGGGCAGAGCTGGTCAGTTA
CAAGCTAGCAAGGACGACCTATATATTGGCAATGCCGGCACAGCATCTCGATTTCTCGCCACCGTCGTCGCCCTC
TGCCAACCTGCGGATGGTGTCAAACACACGATACTTACTGGCAATGATCGCATGAAGACCCGGCCGATAGGTCCC
CTTGTCGATGCGTTGCGATCGAACGGAGTTGATGTCGAGTATCTCGAGCAGGACAAAAGTCTTCCGCTTCGGATC
CACGCTGCTGGTGGGTTTGACGGAGGACTCATCGAACTAGCTGCGACTGTGTCCTCCCAGTACGTCTCGTCTATA
CTGATGGCCGCGCCATATGCCAAGAAACCGGTTACGCTTCGCTTGGTCGGGGGGAAACCAGTCTCCCAACCCTAT
ATTGACATGACAATCTCCATGATGCTTTCGTTTGGGCTGGTAGTCACCAGGTCCGATGTGGAAACCAACACCTAC
CACATCCCTCAGGGTGTCTACCGCAACCCCCCAGAATACATGATTGAGAGTGACGCAAGCTCGGCCACCTACCCG
CTTGCTGTGGCCGCAATCACCGGGATGACCTGCGTCGTCCCAAATATTGGATTCCAGTCTCTCCAGGGCGATGCA
CGCTTCGCCGTGGACGTCTTGAGACCTATGGGCTGTCTCGTTGAACAGGACGAGGTTTCCACGAAAGTCACAGGG
CCGCCCGTTGGAACATTGCGAGGGCTTCCGCATGTGGACATGGAGCCCATGACGGATGCCTTCCTAACAGCATCG
GTACTGGCAGCAGTTGCACAAGGCACAACGCAAATCACGGGTATCGCAAACCAAAGAGTCAAAGAATGCAACAGA
ATCAAGGCCATGGTGGATGAGATTTCCAAATTTGGCGTCAAATGCTCTGAACTTGAAGATGGCATCGAAATACAT
GGCGATTCGCTGACAGGCATGCGGTCTGCAGATGCGAAGATCCATTGCTACGACGATCATCGCGTCGCCATGAGC
CTCAGCGTCTTGGCCGTTGCCTCGCCAGGTGCTACAATCATCACGCAACGCGAATGTGTGGGAAAGACCTGGCCT
GGATGGTGGGATACACTCACTCAGTCTTTCCGGGTCACTCTGGCAGGCATCGATGAGACTCCGGACCATCAGCGT
ACGCCCGCTGACGGCGACGCCGAACGCTCGATTTTCGTCATCGGGATGAGAGGCGCAGGGAAGACAACGGTTGGA
CAGTGGATGGCGGCTCTACTGGGCTGGGAATTCTCCGACTTAGACCAAGAACTTGAAAAGCGGTCAGGTAAATCT
ATCATTGAGATGGTCAGTGGATCAGGTCAATGGGAGGGTTTTCGCCAGGCAGAGCTGGAATTGTTACGCGACACA
ATGGCAAATCAACCCTTGCGTCATGTCTTCTCTTGTGGCGGAGGAGTTGTGGAAACTCCACAAGCAAGAGATCTC
TTGACGGCGCATTGCCGCCGGGGTGGTTACGTCGTTCTCGTCCACCGCAGCCTTGACCAGATTGTGGACTACTTG
AAGCAGGACGAGTCTCGACCGGCTTACGCAAGTGACGTTCGCGAAGTTTATCAGCGACGCAAGCTGTGGTACGAG
CAGTGCAGTAATTACGTCTATTTCAGCCCTCATTCAGGCAGTTCCGGCAGTGCTGGGGAAATCCCCGATGACTTG
GAACTCTTTATGGCCTCGATGCGGGGAAGCAGCGGTCACTTGGACAGCATGGCTACCAAGGGAAAGTCCAGCTTC
TTCGTTTCACTCACACTGCCCAACCTCTTCAAGGCGCGAGAGCTGATCCCTCGCGTCGTTGACGGGGCTGATGCC
GTCGAGCTTCGCGTCGATCTCCTGGAAGATCAAAGTCCAGAAGCGGTGCTCGAGCAGGTATCTATCCTGCGTTCC
TCGGCCAGGAGGCCGATCATTTTCACTGTCCGCACCCAGTCTCAGGGAGGGCAATTTCCCGACGATGCAGTTGGG
GAGCTCCAGACGCTTCATCGTTTGGCACTGCGGGTGGCCGTAGAGTACCTCGACGTCGAGGTAACGGCCACTGAC
GACACACTTCAGATGGTAACAGACCTGCGCGGACACACGCAGATCATTGCCTCGCATCACGATCCGCTCGGTAAC
TTGGCCTGGAAGAATGCCTCGTGGATTCCCTTCTATAATAGGGCTTTGCAATACGGAAACATCATCAAGCTCGTC
GGCACTGCCCGGACCTTGGAGGACAATTACCATCTGGCGAGCTTCAAGTCCAGAATGCTTGCTTCGCAGGAGATC
CCGATCATTGCGATTAACATGGGTTCTATGGGAAAGCTCAGTCGTATCTTGAACGGGTTCCTTACCCCTGTTACC
CATCCGGATCTGCCGTTCCCAGCTGCGCCAGGCCAATTGTCGGCAACCGAGATCCGTCAAGGCTTGACGCTACTC
GGCCAAATCGACGCGCAAAGATTTTACCTCTTCGGCAAACCAATCTCGCAGTCAAAATCGCCTGCCATTCACAAC
CACCTCTTTCGACGGATGGGTCTGCCGCATTGTTACGAGCTCCGGGAGACCGACGATGTCGCACAAGTAGAGCAG
GTTCTACAGTCTGCGAAGTTTGGGGGGGCATCTGTTACCATACCCCTGAAGCGTCATGTCATGTCACTGGTCGAC
GAACTAACACCGGCTGCCAAGATCATTGGCGCCATCAACACCATCATCCCGATGGCGGAAGCGGATTCAAGCAAT
CGTCCTCGCCTTCTCGGTGACAATACCGACTGGAAGGGCATTGTGCGGACGCTGAGGCAGAGCGGAGCATCGTCG
CATAACAACGGGGCTTGCGCGATGGTGGTTGGCTCTGGAGGCACGACACGGGCAGCTGTTTATGCCCTCCGCTCG
ATGGGTTACTGTCCAATCTACATCATAGCGCGGGATCCAAGTAAAGCTCTGGAACTGGCAGCTGGTTTCCCAAGC
GACTACAACATCCAAGTCGTGGCAACACATTCGGAGTTTGTGAACAAGAAAGCCTGCCCGAGAGTCATCATCAAC
ACCATTCCGGGTGACACACCGATAGACTCAAAGGTGAAGGAGATCCTCCTCGCAGCTCTCGAGACTACAGAAAAG
CAGCCTATCTGTCGCGTCCTGGTCGAAATGGCTTACAAGCCTCGCGTGACTCCCGTCATGGAACTTGCTGGTGCA
GCGGGCGGTTGGAGAGTGATACCGGGGCTCGAGCCGCTGGTGTCCCAAGGATGCTACCAGTTTGAGCTTTGGACT
GGCATAATACCGTCGCAAGACGCTGCGCGGGAAGCTGTGGGTACCTAG
Transcript >Ophun1|2093
ATGGCGCAGTTCGAAGACCGTTCGCCGGAAACGATATCTATCCTGGGCGAAGCCAGCATTGTTGCCGACTACGCT
CTTTGGCCTGCCGCAGTCGCAAAAGACCTTTGCCGGAACTCACCAGCTTCCACATATGTTCTCATAACCGACACG
AATCTGCACGACATCTACGTGCCCTCTTTTCGGGATTTCTTCGACAGTCATCGGGACAAAAAGGCGACTCGTCAG
CTGTTGACGTACGCCGTGCCGCCCGGTGAGGCCTCAAAATGCCGCGAAACCAAGGCAGAGATCGAGGACTGGATG
CTGTCCCAAAGCTGCACGCGAGATACTGTCCTGATAGCTCTCGGTGGTGGAGTAATTGGTGATATGATTGGATAT
GTTGCTGCAACTTTCATGCGAGGCATTCGCTTCGTTCAGGTACCGACAACTTTGCTTGCCATGGTTGACTCGTCT
ATTGGAGGCAAGACCGCCATCGACACGCCCATGGGCAAGAACTTGGTTGGAGCCTTTTGGCAGCCGCGCCGCATT
TACATTGACCTGGATTTCTTAGAGACCCTTCCTCCACGCGAATTCTTCAATGGTATGTCGGAGGTCATCAAAACG
GCCGCCATTTGGGACGAAGCCGAGTTTGCTTTCCTGGAGCAACAAGCCGCACATATTGTAGAGTGTGCTCGTTCA
ACTGCTAAAAACCGTCTCCAGCCGGTTAAAGAAGCTGTGAAGCGAATTGTCGTCAACGCGGCACGTGTCAAAGCC
GACGTCGTCACCAGAGATGAGCGAGAAGGTGGCTTGCGCAATCTCCTCAATTTTGGACACTCCATCGGCCACGCA
ATAGAGGCCATCTTGGCCCCCCAGATTCTCCACGGCGAAGCGGTTGCTATCGGAATGGTCAAGGAAGCAGAATTG
GCCCGCTTCGTTGGAGTTCTCCGTCCCCATGCCGTGGCCAGACTCTCCAAATGCATTGCGTCGTTTGGGCTTCCT
ACATCATTGCACGACAAGCAGGTTGTCAAGTTAACTGCAGGCAAGCAGTGTCAAGTGGAGGAGATGCTGCAAAAG
ATGTCGGTCGACAAGAAGAACGACGGCGAACAGAAGAAGGTGGTGCTGTTATCTGCCATTGGCAAGACTCATGAA
AACAAAGCCAGTGCGGTGGATGATGGTTCCATCAAACTCATCCTAAGTTCCTCCGTCCGAGTCACACCTGGCGTG
CCTCCAAATTTGCAGGCCACCGTCACTCCGCCTGGTTCCAAGAGCATCTCCAACCGGGCGTTGATCATGGCGGCA
CTCGGATCCGGCCGCTGCCGCCTGAAAAACCTGCTTCACTCTGACGACACAGAGTACATGCTATCCGCCATTACG
CGTCTTCGTGGCGCATCTTTCTCTTGGCAAGACGCTGGTGAGGTGCTCGAAGTTCAGGGCAGAGCTGGTCAGTTA
CAAGCTAGCAAGGACGACCTATATATTGGCAATGCCGGCACAGCATCTCGATTTCTCGCCACCGTCGTCGCCCTC
TGCCAACCTGCGGATGGTGTCAAACACACGATACTTACTGGCAATGATCGCATGAAGACCCGGCCGATAGGTCCC
CTTGTCGATGCGTTGCGATCGAACGGAGTTGATGTCGAGTATCTCGAGCAGGACAAAAGTCTTCCGCTTCGGATC
CACGCTGCTGGTGGGTTTGACGGAGGACTCATCGAACTAGCTGCGACTGTGTCCTCCCAGTACGTCTCGTCTATA
CTGATGGCCGCGCCATATGCCAAGAAACCGGTTACGCTTCGCTTGGTCGGGGGGAAACCAGTCTCCCAACCCTAT
ATTGACATGACAATCTCCATGATGCTTTCGTTTGGGCTGGTAGTCACCAGGTCCGATGTGGAAACCAACACCTAC
CACATCCCTCAGGGTGTCTACCGCAACCCCCCAGAATACATGATTGAGAGTGACGCAAGCTCGGCCACCTACCCG
CTTGCTGTGGCCGCAATCACCGGGATGACCTGCGTCGTCCCAAATATTGGATTCCAGTCTCTCCAGGGCGATGCA
CGCTTCGCCGTGGACGTCTTGAGACCTATGGGCTGTCTCGTTGAACAGGACGAGGTTTCCACGAAAGTCACAGGG
CCGCCCGTTGGAACATTGCGAGGGCTTCCGCATGTGGACATGGAGCCCATGACGGATGCCTTCCTAACAGCATCG
GTACTGGCAGCAGTTGCACAAGGCACAACGCAAATCACGGGTATCGCAAACCAAAGAGTCAAAGAATGCAACAGA
ATCAAGGCCATGGTGGATGAGATTTCCAAATTTGGCGTCAAATGCTCTGAACTTGAAGATGGCATCGAAATACAT
GGCGATTCGCTGACAGGCATGCGGTCTGCAGATGCGAAGATCCATTGCTACGACGATCATCGCGTCGCCATGAGC
CTCAGCGTCTTGGCCGTTGCCTCGCCAGGTGCTACAATCATCACGCAACGCGAATGTGTGGGAAAGACCTGGCCT
GGATGGTGGGATACACTCACTCAGTCTTTCCGGGTCACTCTGGCAGGCATCGATGAGACTCCGGACCATCAGCGT
ACGCCCGCTGACGGCGACGCCGAACGCTCGATTTTCGTCATCGGGATGAGAGGCGCAGGGAAGACAACGGTTGGA
CAGTGGATGGCGGCTCTACTGGGCTGGGAATTCTCCGACTTAGACCAAGAACTTGAAAAGCGGTCAGGTAAATCT
ATCATTGAGATGGTCAGTGGATCAGGTCAATGGGAGGGTTTTCGCCAGGCAGAGCTGGAATTGTTACGCGACACA
ATGGCAAATCAACCCTTGCGTCATGTCTTCTCTTGTGGCGGAGGAGTTGTGGAAACTCCACAAGCAAGAGATCTC
TTGACGGCGCATTGCCGCCGGGGTGGTTACGTCGTTCTCGTCCACCGCAGCCTTGACCAGATTGTGGACTACTTG
AAGCAGGACGAGTCTCGACCGGCTTACGCAAGTGACGTTCGCGAAGTTTATCAGCGACGCAAGCTGTGGTACGAG
CAGTGCAGTAATTACGTCTATTTCAGCCCTCATTCAGGCAGTTCCGGCAGTGCTGGGGAAATCCCCGATGACTTG
GAACTCTTTATGGCCTCGATGCGGGGAAGCAGCGGTCACTTGGACAGCATGGCTACCAAGGGAAAGTCCAGCTTC
TTCGTTTCACTCACACTGCCCAACCTCTTCAAGGCGCGAGAGCTGATCCCTCGCGTCGTTGACGGGGCTGATGCC
GTCGAGCTTCGCGTCGATCTCCTGGAAGATCAAAGTCCAGAAGCGGTGCTCGAGCAGGTATCTATCCTGCGTTCC
TCGGCCAGGAGGCCGATCATTTTCACTGTCCGCACCCAGTCTCAGGGAGGGCAATTTCCCGACGATGCAGTTGGG
GAGCTCCAGACGCTTCATCGTTTGGCACTGCGGGTGGCCGTAGAGTACCTCGACGTCGAGGTAACGGCCACTGAC
GACACACTTCAGATGGTAACAGACCTGCGCGGACACACGCAGATCATTGCCTCGCATCACGATCCGCTCGGTAAC
TTGGCCTGGAAGAATGCCTCGTGGATTCCCTTCTATAATAGGGCTTTGCAATACGGAAACATCATCAAGCTCGTC
GGCACTGCCCGGACCTTGGAGGACAATTACCATCTGGCGAGCTTCAAGTCCAGAATGCTTGCTTCGCAGGAGATC
CCGATCATTGCGATTAACATGGGTTCTATGGGAAAGCTCAGTCGTATCTTGAACGGGTTCCTTACCCCTGTTACC
CATCCGGATCTGCCGTTCCCAGCTGCGCCAGGCCAATTGTCGGCAACCGAGATCCGTCAAGGCTTGACGCTACTC
GGCCAAATCGACGCGCAAAGATTTTACCTCTTCGGCAAACCAATCTCGCAGTCAAAATCGCCTGCCATTCACAAC
CACCTCTTTCGACGGATGGGTCTGCCGCATTGTTACGAGCTCCGGGAGACCGACGATGTCGCACAAGTAGAGCAG
GTTCTACAGTCTGCGAAGTTTGGGGGGGCATCTGTTACCATACCCCTGAAGCGTCATGTCATGTCACTGGTCGAC
GAACTAACACCGGCTGCCAAGATCATTGGCGCCATCAACACCATCATCCCGATGGCGGAAGCGGATTCAAGCAAT
CGTCCTCGCCTTCTCGGTGACAATACCGACTGGAAGGGCATTGTGCGGACGCTGAGGCAGAGCGGAGCATCGTCG
CATAACAACGGGGCTTGCGCGATGGTGGTTGGCTCTGGAGGCACGACACGGGCAGCTGTTTATGCCCTCCGCTCG
ATGGGTTACTGTCCAATCTACATCATAGCGCGGGATCCAAGTAAAGCTCTGGAACTGGCAGCTGGTTTCCCAAGC
GACTACAACATCCAAGTCGTGGCAACACATTCGGAGTTTGTGAACAAGAAAGCCTGCCCGAGAGTCATCATCAAC
ACCATTCCGGGTGACACACCGATAGACTCAAAGGTGAAGGAGATCCTCCTCGCAGCTCTCGAGACTACAGAAAAG
CAGCCTATCTGTCGCGTCCTGGTCGAAATGGCTTACAAGCCTCGCGTGACTCCCGTCATGGAACTTGCTGGTGCA
GCGGGCGGTTGGAGAGTGATACCGGGGCTCGAGCCGCTGGTGTCCCAAGGATGCTACCAGTTTGAGCTTTGGACT
GGCATAATACCGTCGCAAGACGCTGCGCGGGAAGCTGTGGGTACCTAG
Gene >Ophun1|2093
ATGGCGCAGTTCGAAGACCGTTCGCCGGAAACGATATCTATCCTGGGCGAAGCCAGCATTGTTGCCGACTACGCT
CTTTGGCCTGCCGCAGTCGCAAAAGACCTTTGCCGGAACTCACCAGCTTCCACATATGTTCTCATAACCGACACG
AATCTGCACGACATCTACGTGCCCTCTTTTCGGGATTTCTTCGACAGTCATCGGGACAAAAAGGCGACTCGTCAG
CTGTTGACGTACGCCGTGCCGCCCGGTGAGGCCTCAAAATGCCGCGAAACCAAGGCAGAGATCGAGGACTGGATG
CTGTCCCAAAGCTGCACGCGAGATACTGTCCTGATAGCTCTCGGTGGTGGAGTAATTGGTGATATGATTGGATAT
GTTGCTGCAACTTTCATGCGAGGCATTCGCTTCGTTCAGGTACCGACAACTTTGCTTGCCATGGTTGACTCGTCT
ATTGGAGGCAAGACCGCCATCGACACGCCCATGGGCAAGAACTTGGTTGGAGCCTTTTGGCAGCCGCGCCGCATT
TACATTGACCTGGATTTCTTAGAGACCCTTCCTCCACGCGAATTCTTCAATGGTATGTCGGAGGTCATCAAAACG
GCCGCCATTTGGGACGAAGCCGAGTTTGCTTTCCTGGAGCAACAAGCCGCACATATTGTAGAGTGTGCTCGTTCA
ACTGCTAAAAACCGTCTCCAGCCGGTTAAAGAAGCTGTGAAGCGAATTGTCGTCAACGCGGCACGTGTCAAAGCC
GACGTCGTCACCAGAGATGAGCGAGAAGGTGGCTTGCGCAATCTCCTCAATTTTGGACACTCCATCGGCCACGCA
ATAGAGGCCATCTTGGCCCCCCAGATTCTCCACGGCGAAGCGGTTGCTATCGGAATGGTCAAGGAAGCAGAATTG
GCCCGCTTCGTTGGAGTTCTCCGTCCCCATGCCGTGGCCAGACTCTCCAAATGCATTGCGTCGTTTGGGCTTCCT
ACATCATTGCACGACAAGCAGGTTGTCAAGTTAACTGCAGGCAAGCAGTGTCAAGTGGAGGAGATGCTGCAAAAG
ATGTCGGTCGACAAGAAGAACGACGGCGAACAGAAGAAGGTGGTGCTGTTATCTGCCATTGGCAAGACTCATGAA
AACAAAGCCAGTGCGGTGGATGATGGTTCCATCAAACTCATCCTAAGTTCCTCCGTCCGAGTCACACCTGGCGTG
CCTCCAAATTTGCAGGCCACCGTCACTCCGCCTGGTTCCAAGAGCATCTCCAACCGGGCGTTGATCATGGCGGCA
CTCGGATCCGGCCGCTGCCGCCTGAAAAACCTGCTTCACTCTGACGACACAGAGTACATGCTATCCGCCATTACG
CGTCTTCGTGGCGCATCTTTCTCTTGGCAAGACGCTGGTGAGGTGCTCGAAGTTCAGGGCAGAGCTGGTCAGTTA
CAAGCTAGCAAGGACGACCTATATATTGGCAATGCCGGCACAGCATCTCGATTTCTCGCCACCGTCGTCGCCCTC
TGCCAACCTGCGGATGGTGTCAAACACACGATACTTACTGGCAATGATCGCATGAAGACCCGGCCGATAGGTCCC
CTTGTCGATGCGTTGCGATCGAACGGAGTTGATGTCGAGTATCTCGAGCAGGACAAAAGTCTTCCGCTTCGGATC
CACGCTGCTGGTGGGTTTGACGGAGGACTCATCGAACTAGCTGCGACTGTGTCCTCCCAGTACGTCTCGTCTATA
CTGATGGCCGCGCCATATGCCAAGAAACCGGTTACGCTTCGCTTGGTCGGGGGGAAACCAGTCTCCCAACCCTAT
ATTGACATGACAATCTCCATGATGCTTTCGTTTGGGCTGGTAGTCACCAGGTCCGATGTGGAAACCAACACCTAC
CACATCCCTCAGGGTGTCTACCGCAACCCCCCAGAATACATGATTGAGAGTGACGCAAGCTCGGCCACCTACCCG
CTTGCTGTGGCCGCAATCACCGGGATGACCTGCGTCGTCCCAAATATTGGATTCCAGTCTCTCCAGGGCGATGCA
CGCTTCGCCGTGGACGTCTTGAGACCTATGGGCTGTCTCGTTGAACAGGACGAGGTTTCCACGAAAGTCACAGGG
CCGCCCGTTGGAACATTGCGAGGGCTTCCGCATGTGGACATGGAGCCCATGACGGATGCCTTCCTAACAGCATCG
GTACTGGCAGCAGTTGCACAAGGCACAACGCAAATCACGGGTATCGCAAACCAAAGAGTCAAAGAATGCAACAGA
ATCAAGGCCATGGTGGATGAGATTTCCAAATTTGGCGTCAAATGCTCTGAACTTGAAGATGGCATCGAAATACAT
GGCGATTCGCTGACAGGCATGCGGTCTGCAGATGCGAAGATCCATTGCTACGACGATCATCGCGTCGCCATGAGC
CTCAGCGTCTTGGCCGTTGCCTCGCCAGGTGCTACAATCATCACGCAACGCGAATGTGTGGGAAAGACCTGGCCT
GGATGGTGGGATACACTCACTCAGTCTTTCCGGGTCACTCTGGCAGGCATCGATGAGACTCCGGACCATCAGCGT
ACGCCCGCTGACGGCGACGCCGAACGCTCGATTTTCGTCATCGGGATGAGAGGCGCAGGGAAGACAACGGTTGGA
CAGTGGATGGCGGCTCTACTGGGCTGGGAATTCTCCGACTTAGACCAAGAACTTGAAAAGCGGTCAGGTAAATCT
ATCATTGAGATGGTCAGTGGATCAGGTCAATGGGAGGGTTTTCGCCAGGCAGAGCTGGAATTGTTACGCGACACA
ATGGCAAATCAACCCTTGCGTCATGTCTTCTCTTGTGGCGGAGGAGTTGTGGAAACTCCACAAGCAAGAGATCTC
TTGACGGCGCATTGCCGCCGGGGTGGTTACGTCGTTCTCGTCCACCGCAGCCTTGACCAGATTGTGGACTACTTG
AAGCAGGACGAGTCTCGACCGGCTTACGCAAGTGACGTTCGCGAAGTTTATCAGCGACGCAAGCTGTGGTACGAG
CAGTGCAGTAATTACGTCTATTTCAGCCCTCATTCAGGCAGTTCCGGCAGTGCTGGGGAAATCCCCGATGACTTG
GAACTCTTTATGGCCTCGATGCGGGGAAGCAGCGGTCACTTGGACAGCATGGCTACCAAGGGAAAGTCCAGCTTC
TTCGTTTCACTCACACTGCCCAACCTCTTCAAGGCGCGAGAGCTGATCCCTCGCGTCGTTGACGGGGCTGATGCC
GTCGAGCTTCGCGTCGATCTCCTGGAAGATCAAAGTCCAGAAGCGGTGCTCGAGCAGGTATCTATCCTGCGTTCC
TCGGCCAGGAGGCCGATCATTTTCACTGTCCGCACCCAGTCTCAGGGAGGGCAATTTCCCGACGATGCAGTTGGG
GAGCTCCAGACGCTTCATCGTTTGGCACTGCGGGTGGCCGTAGAGTACCTCGACGTCGAGGTAACGGCCACTGAC
GACACACTTCAGATGGTAACAGACCTGCGCGGACACACGCAGATCATTGCCTCGCATCACGATCCGCTCGGTAAC
TTGGCCTGGAAGAATGCCTCGTGGATTCCCTTCTATAATAGGGCTTTGCAATACGGAAACATCATCAAGCTCGTC
GGCACTGCCCGGACCTTGGAGGACAATTACCATCTGGCGAGCTTCAAGTCCAGAATGCTTGCTTCGCAGGAGATC
CCGATCATTGCGATTAACATGGGTTCTATGGGAAAGCTCAGTCGTATCTTGAACGGGTTCCTTACCCCTGTTACC
CATCCGGATCTGCCGTTCCCAGCTGCGCCAGGCCAATTGTCGGCAACCGAGATCCGTCAAGGCTTGACGCTACTC
GGCCAAATCGACGCGCAAAGATTTTACCTCTTCGGCAAACCAATCTCGCAGTCAAAATCGCCTGCCATTCACAAC
CACCTCTTTCGACGGATGGGTCTGCCGCATTGTTACGAGCTCCGGGAGACCGACGATGTCGCACAAGTAGAGCAG
GTTCTACAGTCTGCGAAGTTTGGGGGGGCATCTGTTACCATACCCCTGAAGCGTCATGTCATGTCACTGGTCGAC
GAACTAACACCGGCTGCCAAGATCATTGGCGCCATCAACACCATCATCCCGATGGCGGAAGCGGATTCAAGCAAT
CGTCCTCGCCTTCTCGGTGACAATACCGACTGGAAGGGCATTGTGCGGACGCTGAGGCAGAGCGGAGCATCGTCG
CATAACAACGGGGCTTGCGCGATGGTGGTTGGCTCTGGAGGCACGACACGGGCAGCTGTTTATGCCCTCCGCTCG
ATGGGTTACTGTCCAATCTACATCATAGCGCGGGATCCAAGTAAAGCTCTGGAACTGGCAGCTGGTTTCCCAAGC
GACTACAACATCCAAGTCGTGGCAACACATTCGGAGTTTGTGAACAAGAAAGCCTGCCCGAGAGTCATCATCAAC
ACCATTCCGGGTGACACACCGATAGACTCAAAGGTGAAGGAGATCCTCCTCGCAGCTCTCGAGACTACAGAAAAG
CAGCCTATCTGTCGCGTCCTGGTCGAAATGGCTTACAAGCCTCGCGTGACTCCCGTCATGGAACTTGCTGGTGCA
GCGGGCGGTTGGAGAGTGATACCGGGGCTCGAGCCGCTGGTGTCCCAAGGATGCTACCAGGTATGTCCAGCTCTG
GTACTGAGAGAGCTGTATCTGACGTACAATTCATTTGCAGTTTGAGCTTTGGACTGGCATAATACCGTCGCAAGA
CGCTGCGCGGGAAGCTGTGGGTACCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail