Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2081
Gene name
LocationContig_198:25842..27988
Strand+
Gene length (bp)2146
Transcript length (bp)2037
Coding sequence length (bp)2037
Protein length (aa) 679

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00085 Thioredoxin Thioredoxin 2.9E-15 40 150
PF00085 Thioredoxin Thioredoxin 9.2E-22 221 319

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P87178|YB1D_SCHPO Uncharacterized protein C3D6.13c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC3D6.13c PE=1 SV=1 213 632 2.0E-69
sp|Q9P4X1|YKV5_SCHPO Thioredoxin domain-containing protein C959.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC959.05c PE=3 SV=4 98 598 9.0E-38
sp|Q91W90|TXND5_MOUSE Thioredoxin domain-containing protein 5 OS=Mus musculus GN=Txndc5 PE=1 SV=2 38 312 1.0E-27
sp|Q8NBS9|TXND5_HUMAN Thioredoxin domain-containing protein 5 OS=Homo sapiens GN=TXNDC5 PE=1 SV=2 38 312 1.0E-27
sp|O74481|YQJ8_SCHPO Uncharacterized protein C1840.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1840.08c PE=3 SV=1 260 587 4.0E-26
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P87178|YB1D_SCHPO Uncharacterized protein C3D6.13c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC3D6.13c PE=1 SV=1 213 632 2.0E-69
sp|Q9P4X1|YKV5_SCHPO Thioredoxin domain-containing protein C959.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC959.05c PE=3 SV=4 98 598 9.0E-38
sp|Q91W90|TXND5_MOUSE Thioredoxin domain-containing protein 5 OS=Mus musculus GN=Txndc5 PE=1 SV=2 38 312 1.0E-27
sp|Q8NBS9|TXND5_HUMAN Thioredoxin domain-containing protein 5 OS=Homo sapiens GN=TXNDC5 PE=1 SV=2 38 312 1.0E-27
sp|O74481|YQJ8_SCHPO Uncharacterized protein C1840.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1840.08c PE=3 SV=1 260 587 4.0E-26
sp|Q8NBS9|TXND5_HUMAN Thioredoxin domain-containing protein 5 OS=Homo sapiens GN=TXNDC5 PE=1 SV=2 58 404 7.0E-25
sp|Q91W90|TXND5_MOUSE Thioredoxin domain-containing protein 5 OS=Mus musculus GN=Txndc5 PE=1 SV=2 58 403 1.0E-24
sp|Q9MAU6|PDI22_ARATH Protein disulfide-isomerase like 2-2 OS=Arabidopsis thaliana GN=PDIL2-2 PE=2 SV=2 37 332 2.0E-23
sp|O48773|PDI23_ARATH Protein disulfide-isomerase 2-3 OS=Arabidopsis thaliana GN=PDIL2-3 PE=2 SV=1 37 332 5.0E-22
sp|Q67UF5|PDI23_ORYSJ Protein disulfide isomerase-like 2-3 OS=Oryza sativa subsp. japonica GN=PDIL2-3 PE=2 SV=1 37 332 3.0E-21
sp|Q942L2|PDI22_ORYSJ Protein disulfide isomerase-like 2-2 OS=Oryza sativa subsp. japonica GN=PDIL2-2 PE=2 SV=1 38 321 1.0E-20
sp|Q869Z0|Y5025_DICDI Putative protein disulfide-isomerase DDB_G0275025 OS=Dictyostelium discoideum GN=DDB_G0275025 PE=1 SV=1 217 399 2.0E-19
sp|O22263|PDI21_ARATH Protein disulfide-isomerase like 2-1 OS=Arabidopsis thaliana GN=PDIL2-1 PE=2 SV=1 41 321 2.0E-19
sp|P38661|PDIA6_MEDSA Probable protein disulfide-isomerase A6 OS=Medicago sativa PE=2 SV=1 41 321 5.0E-19
sp|Q922R8|PDIA6_MOUSE Protein disulfide-isomerase A6 OS=Mus musculus GN=Pdia6 PE=1 SV=3 38 319 2.0E-17
sp|Q63081|PDIA6_RAT Protein disulfide-isomerase A6 OS=Rattus norvegicus GN=Pdia6 PE=1 SV=2 38 319 2.0E-17
sp|P38660|PDIA6_MESAU Protein disulfide-isomerase A6 OS=Mesocricetus auratus GN=PDIA6 PE=1 SV=1 38 354 1.0E-16
sp|Q5R6T1|PDIA6_PONAB Protein disulfide-isomerase A6 OS=Pongo abelii GN=PDIA6 PE=2 SV=1 8 319 1.0E-16
sp|Q75M08|PDI21_ORYSJ Protein disulfide isomerase-like 2-1 OS=Oryza sativa subsp. japonica GN=PDIL2-1 PE=2 SV=2 38 321 1.0E-16
sp|Q15084|PDIA6_HUMAN Protein disulfide-isomerase A6 OS=Homo sapiens GN=PDIA6 PE=1 SV=1 38 319 2.0E-16
sp|P34329|PDIA4_CAEEL Probable protein disulfide-isomerase A4 OS=Caenorhabditis elegans GN=C14B9.2 PE=3 SV=2 2 493 2.0E-16
sp|P13667|PDIA4_HUMAN Protein disulfide-isomerase A4 OS=Homo sapiens GN=PDIA4 PE=1 SV=2 38 453 2.0E-16
sp|Q8GYD1|PDI51_ARATH Protein disulfide-isomerase 5-1 OS=Arabidopsis thaliana GN=PDIL5-1 PE=2 SV=1 221 337 3.0E-16
sp|Q54EN4|PDI2_DICDI Protein disulfide-isomerase 2 OS=Dictyostelium discoideum GN=pdi2 PE=3 SV=1 223 438 4.0E-16
sp|Q4N4N8|TXND_THEPA Thioredoxin domain-containing protein OS=Theileria parva GN=TP02_0602 PE=1 SV=1 221 388 7.0E-16
sp|P38659|PDIA4_RAT Protein disulfide-isomerase A4 OS=Rattus norvegicus GN=Pdia4 PE=1 SV=2 41 342 2.0E-15
sp|P08003|PDIA4_MOUSE Protein disulfide-isomerase A4 OS=Mus musculus GN=Pdia4 PE=1 SV=3 41 342 2.0E-15
sp|Q5R5L3|DJC10_PONAB DnaJ homolog subfamily C member 10 OS=Pongo abelii GN=DNAJC10 PE=2 SV=1 41 298 3.0E-15
sp|Q8IXB1|DJC10_HUMAN DnaJ homolog subfamily C member 10 OS=Homo sapiens GN=DNAJC10 PE=1 SV=2 41 298 3.0E-15
sp|Q29RV1|PDIA4_BOVIN Protein disulfide-isomerase A4 OS=Bos taurus GN=PDIA4 PE=2 SV=1 38 453 7.0E-15
sp|Q00248|PDI_ASPOR Protein disulfide-isomerase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=pdiA PE=3 SV=1 221 439 3.0E-14
sp|Q10N04|PDI51_ORYSJ Protein disulfide isomerase-like 5-1 OS=Oryza sativa subsp. japonica GN=PDIL5-1 PE=2 SV=1 221 327 4.0E-14
sp|Q00216|TIGA_ASPNG Protein disulfide-isomerase tigA OS=Aspergillus niger GN=tigA PE=2 SV=1 32 342 4.0E-14
sp|Q86IA3|PDI1_DICDI Protein disulfide-isomerase 1 OS=Dictyostelium discoideum GN=pdi1 PE=1 SV=2 41 341 4.0E-14
sp|Q5R5L3|DJC10_PONAB DnaJ homolog subfamily C member 10 OS=Pongo abelii GN=DNAJC10 PE=2 SV=1 221 311 5.0E-14
sp|P13667|PDIA4_HUMAN Protein disulfide-isomerase A4 OS=Homo sapiens GN=PDIA4 PE=1 SV=2 217 476 6.0E-14
sp|P38659|PDIA4_RAT Protein disulfide-isomerase A4 OS=Rattus norvegicus GN=Pdia4 PE=1 SV=2 217 456 6.0E-14
sp|Q8IXB1|DJC10_HUMAN DnaJ homolog subfamily C member 10 OS=Homo sapiens GN=DNAJC10 PE=1 SV=2 221 311 7.0E-14
sp|P12865|BS2_TRYBB Bloodstream-specific protein 2 OS=Trypanosoma brucei brucei GN=BS2 PE=3 SV=1 220 358 2.0E-13
sp|Q29RV1|PDIA4_BOVIN Protein disulfide-isomerase A4 OS=Bos taurus GN=PDIA4 PE=2 SV=1 217 470 4.0E-13
sp|Q9DC23|DJC10_MOUSE DnaJ homolog subfamily C member 10 OS=Mus musculus GN=Dnajc10 PE=1 SV=2 221 311 4.0E-13
sp|Q498R3|DJC10_RAT DnaJ homolog subfamily C member 10 OS=Rattus norvegicus GN=Dnajc10 PE=2 SV=2 221 311 6.0E-13
sp|Q11067|PDIA6_CAEEL Probable protein disulfide-isomerase A6 OS=Caenorhabditis elegans GN=tag-320 PE=3 SV=1 221 332 7.0E-13
sp|P08003|PDIA4_MOUSE Protein disulfide-isomerase A4 OS=Mus musculus GN=Pdia4 PE=1 SV=3 217 464 8.0E-13
sp|Q17770|PDI2_CAEEL Protein disulfide-isomerase 2 OS=Caenorhabditis elegans GN=pdi-2 PE=1 SV=1 221 483 1.0E-12
sp|Q6NRT6|DJC10_XENLA DnaJ homolog subfamily C member 10 OS=Xenopus laevis GN=dnajc10 PE=2 SV=1 219 308 2.0E-12
sp|Q12730|PDI_ASPNG Protein disulfide-isomerase OS=Aspergillus niger GN=pdiA PE=2 SV=1 211 439 2.0E-12
sp|Q6NRT6|DJC10_XENLA DnaJ homolog subfamily C member 10 OS=Xenopus laevis GN=dnajc10 PE=2 SV=1 239 319 3.0E-12
sp|P55059|PDI_HUMIN Protein disulfide-isomerase OS=Humicola insolens PE=1 SV=1 221 450 6.0E-12
sp|Q17967|PDI1_CAEEL Protein disulfide-isomerase 1 OS=Caenorhabditis elegans GN=pdi-1 PE=3 SV=1 223 450 8.0E-12
sp|Q6NRT6|DJC10_XENLA DnaJ homolog subfamily C member 10 OS=Xenopus laevis GN=dnajc10 PE=2 SV=1 221 313 1.0E-11
sp|Q91W90|TXND5_MOUSE Thioredoxin domain-containing protein 5 OS=Mus musculus GN=Txndc5 PE=1 SV=2 240 404 2.0E-11
sp|Q498R3|DJC10_RAT DnaJ homolog subfamily C member 10 OS=Rattus norvegicus GN=Dnajc10 PE=2 SV=2 239 319 2.0E-11
sp|Q96JJ7|TMX3_HUMAN Protein disulfide-isomerase TMX3 OS=Homo sapiens GN=TMX3 PE=1 SV=2 226 350 2.0E-11
sp|P09102|PDIA1_CHICK Protein disulfide-isomerase OS=Gallus gallus GN=P4HB PE=1 SV=3 217 486 2.0E-11
sp|Q9DC23|DJC10_MOUSE DnaJ homolog subfamily C member 10 OS=Mus musculus GN=Dnajc10 PE=1 SV=2 239 319 3.0E-11
sp|Q5R5B6|PDIA1_PONAB Protein disulfide-isomerase OS=Pongo abelii GN=P4HB PE=2 SV=1 241 486 3.0E-11
sp|Q10057|PDI1_SCHPO Putative protein disulfide-isomerase C1F5.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1F5.02 PE=3 SV=1 226 354 4.0E-11
sp|Q5RDG4|PDIA3_PONAB Protein disulfide-isomerase A3 OS=Pongo abelii GN=PDIA3 PE=2 SV=1 221 367 5.0E-11
sp|P30101|PDIA3_HUMAN Protein disulfide-isomerase A3 OS=Homo sapiens GN=PDIA3 PE=1 SV=4 221 367 5.0E-11
sp|P07237|PDIA1_HUMAN Protein disulfide-isomerase OS=Homo sapiens GN=P4HB PE=1 SV=3 241 483 6.0E-11
sp|Q8IXB1|DJC10_HUMAN DnaJ homolog subfamily C member 10 OS=Homo sapiens GN=DNAJC10 PE=1 SV=2 221 324 7.0E-11
sp|P21195|PDIA1_RABIT Protein disulfide-isomerase OS=Oryctolagus cuniculus GN=P4HB PE=2 SV=1 240 450 7.0E-11
sp|Q54EN4|PDI2_DICDI Protein disulfide-isomerase 2 OS=Dictyostelium discoideum GN=pdi2 PE=3 SV=1 201 345 8.0E-11
sp|Q5R875|TMX3_PONAB Protein disulfide-isomerase TMX3 OS=Pongo abelii GN=TMX3 PE=2 SV=1 226 350 8.0E-11
sp|Q2HWU2|PDIA1_MACFU Protein disulfide-isomerase OS=Macaca fuscata fuscata GN=P4HB PE=2 SV=1 241 483 8.0E-11
sp|Q4VIT4|PDIA3_CHLAE Protein disulfide-isomerase A3 OS=Chlorocebus aethiops GN=PDIA3 PE=2 SV=1 221 353 8.0E-11
sp|Q5R5L3|DJC10_PONAB DnaJ homolog subfamily C member 10 OS=Pongo abelii GN=DNAJC10 PE=2 SV=1 221 324 9.0E-11
sp|Q8BXZ1|TMX3_MOUSE Protein disulfide-isomerase TMX3 OS=Mus musculus GN=Tmx3 PE=1 SV=2 237 350 9.0E-11
sp|Q12404|MPD1_YEAST Protein disulfide-isomerase MPD1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MPD1 PE=1 SV=1 223 299 1.0E-10
sp|P05307|PDIA1_BOVIN Protein disulfide-isomerase OS=Bos taurus GN=P4HB PE=1 SV=1 241 483 1.0E-10
sp|Q50KB1|SEP2_EMIHU Protein disulfide-isomerase-like protein EhSep2 OS=Emiliania huxleyi GN=SEP2 PE=1 SV=2 221 323 2.0E-10
sp|Q6GNG3|TMX3_XENLA Protein disulfide-isomerase TMX3 OS=Xenopus laevis GN=tmx3 PE=2 SV=1 237 361 2.0E-10
sp|P27773|PDIA3_MOUSE Protein disulfide-isomerase A3 OS=Mus musculus GN=Pdia3 PE=1 SV=2 221 352 2.0E-10
sp|D4B2L8|PDI_ARTBC Protein disulfide-isomerase OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02626 PE=3 SV=1 222 450 2.0E-10
sp|P38657|PDIA3_BOVIN Protein disulfide-isomerase A3 OS=Bos taurus GN=PDIA3 PE=2 SV=1 221 352 3.0E-10
sp|Q92249|ERP38_NEUCR Protein disulfide-isomerase erp38 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=erp38 PE=2 SV=2 223 321 4.0E-10
sp|P11598|PDIA3_RAT Protein disulfide-isomerase A3 OS=Rattus norvegicus GN=Pdia3 PE=1 SV=2 221 352 6.0E-10
sp|Q11067|PDIA6_CAEEL Probable protein disulfide-isomerase A6 OS=Caenorhabditis elegans GN=tag-320 PE=3 SV=1 221 310 8.0E-10
sp|Q86IA3|PDI1_DICDI Protein disulfide-isomerase 1 OS=Dictyostelium discoideum GN=pdi1 PE=1 SV=2 211 318 1.0E-09
sp|Q9DC23|DJC10_MOUSE DnaJ homolog subfamily C member 10 OS=Mus musculus GN=Dnajc10 PE=1 SV=2 219 299 1.0E-09
sp|P04785|PDIA1_RAT Protein disulfide-isomerase OS=Rattus norvegicus GN=P4hb PE=1 SV=2 241 450 1.0E-09
sp|Q8NBS9|TXND5_HUMAN Thioredoxin domain-containing protein 5 OS=Homo sapiens GN=TXNDC5 PE=1 SV=2 240 404 2.0E-09
sp|D4B2L8|PDI_ARTBC Protein disulfide-isomerase OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02626 PE=3 SV=1 1 153 2.0E-09
sp|P09103|PDIA1_MOUSE Protein disulfide-isomerase OS=Mus musculus GN=P4hb PE=1 SV=2 241 450 2.0E-09
sp|P54399|PDI_DROME Protein disulfide-isomerase OS=Drosophila melanogaster GN=Pdi PE=2 SV=1 218 316 2.0E-09
sp|Q498R3|DJC10_RAT DnaJ homolog subfamily C member 10 OS=Rattus norvegicus GN=Dnajc10 PE=2 SV=2 219 298 3.0E-09
sp|O00391|QSOX1_HUMAN Sulfhydryl oxidase 1 OS=Homo sapiens GN=QSOX1 PE=1 SV=3 223 300 3.0E-09
sp|Q94F09|PDI52_ARATH Protein disulfide-isomerase 5-2 OS=Arabidopsis thaliana GN=PDIL5-2 PE=1 SV=1 217 486 3.0E-09
sp|P38658|ERP60_SCHMA Probable protein disulfide-isomerase ER-60 OS=Schistosoma mansoni PE=3 SV=1 227 487 3.0E-09
sp|H2N4I1|QSOX1_PONAB Sulfhydryl oxidase 1 OS=Pongo abelii GN=QSOX1 PE=3 SV=2 223 300 3.0E-09
sp|P07591|TRXM_SPIOL Thioredoxin M-type, chloroplastic OS=Spinacia oleracea PE=1 SV=2 227 305 4.0E-09
sp|O08841|QSOX1_CAVPO Sulfhydryl oxidase 1 OS=Cavia porcellus GN=QSOX1 PE=2 SV=2 223 300 5.0E-09
sp|Q8R4U2|PDIA1_CRIGR Protein disulfide-isomerase OS=Cricetulus griseus GN=P4HB PE=2 SV=1 241 450 5.0E-09
sp|Q10057|PDI1_SCHPO Putative protein disulfide-isomerase C1F5.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1F5.02 PE=3 SV=1 54 153 6.0E-09
sp|Q8IXB1|DJC10_HUMAN DnaJ homolog subfamily C member 10 OS=Homo sapiens GN=DNAJC10 PE=1 SV=2 219 324 8.0E-09
sp|Q00216|TIGA_ASPNG Protein disulfide-isomerase tigA OS=Aspergillus niger GN=tigA PE=2 SV=1 221 348 8.0E-09
sp|Q5R5L3|DJC10_PONAB DnaJ homolog subfamily C member 10 OS=Pongo abelii GN=DNAJC10 PE=2 SV=1 219 324 1.0E-08
sp|Q9DC23|DJC10_MOUSE DnaJ homolog subfamily C member 10 OS=Mus musculus GN=Dnajc10 PE=1 SV=2 219 352 1.0E-08
sp|Q498R3|DJC10_RAT DnaJ homolog subfamily C member 10 OS=Rattus norvegicus GN=Dnajc10 PE=2 SV=2 219 352 1.0E-08
sp|Q17770|PDI2_CAEEL Protein disulfide-isomerase 2 OS=Caenorhabditis elegans GN=pdi-2 PE=1 SV=1 201 320 1.0E-08
sp|Q6AX23|QSOX2_XENLA Sulfhydryl oxidase 2 OS=Xenopus laevis GN=qsox2 PE=2 SV=1 223 314 1.0E-08
sp|Q9T042|PDI54_ARATH Protein disulfide-isomerase 5-4 OS=Arabidopsis thaliana GN=PDIL5-4 PE=2 SV=1 220 301 1.0E-08
sp|Q10057|PDI1_SCHPO Putative protein disulfide-isomerase C1F5.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1F5.02 PE=3 SV=1 221 321 2.0E-08
sp|P11598|PDIA3_RAT Protein disulfide-isomerase A3 OS=Rattus norvegicus GN=Pdia3 PE=1 SV=2 209 318 2.0E-08
sp|P55059|PDI_HUMIN Protein disulfide-isomerase OS=Humicola insolens PE=1 SV=1 38 153 3.0E-08
sp|Q8JG64|PDIA3_CHICK Protein disulfide-isomerase A3 OS=Gallus gallus GN=PDIA3 PE=2 SV=1 215 318 3.0E-08
sp|Q8BND5|QSOX1_MOUSE Sulfhydryl oxidase 1 OS=Mus musculus GN=Qsox1 PE=1 SV=1 223 317 3.0E-08
sp|P33791|THIO_STRAU Thioredoxin (Fragment) OS=Streptomyces aureofaciens GN=trxA PE=3 SV=1 218 302 3.0E-08
sp|Q00248|PDI_ASPOR Protein disulfide-isomerase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=pdiA PE=3 SV=1 201 321 4.0E-08
sp|P38657|PDIA3_BOVIN Protein disulfide-isomerase A3 OS=Bos taurus GN=PDIA3 PE=2 SV=1 209 318 4.0E-08
sp|P12244|GSBP_CHICK Dolichyl-diphosphooligosaccharide--protein glycotransferase OS=Gallus gallus PE=2 SV=2 241 486 4.0E-08
sp|Q6IUU3|QSOX1_RAT Sulfhydryl oxidase 1 OS=Rattus norvegicus GN=Qsox1 PE=1 SV=1 223 300 4.0E-08
sp|Q41864|TRXM_MAIZE Thioredoxin M-type, chloroplastic OS=Zea mays GN=TRM1 PE=2 SV=1 226 305 4.0E-08
sp|Q5RDG4|PDIA3_PONAB Protein disulfide-isomerase A3 OS=Pongo abelii GN=PDIA3 PE=2 SV=1 209 318 5.0E-08
sp|P30101|PDIA3_HUMAN Protein disulfide-isomerase A3 OS=Homo sapiens GN=PDIA3 PE=1 SV=4 209 318 5.0E-08
sp|Q17967|PDI1_CAEEL Protein disulfide-isomerase 1 OS=Caenorhabditis elegans GN=pdi-1 PE=3 SV=1 38 130 6.0E-08
sp|Q4VIT4|PDIA3_CHLAE Protein disulfide-isomerase A3 OS=Chlorocebus aethiops GN=PDIA3 PE=2 SV=1 209 318 6.0E-08
sp|Q9SEU6|TRXM4_ARATH Thioredoxin M4, chloroplastic OS=Arabidopsis thaliana GN=At3g15360 PE=2 SV=2 222 303 6.0E-08
sp|P0AGG7|THIO2_SHIFL Thioredoxin-2 OS=Shigella flexneri GN=trxC PE=3 SV=1 217 302 6.0E-08
sp|P0AGG4|THIO2_ECOLI Thioredoxin-2 OS=Escherichia coli (strain K12) GN=trxC PE=1 SV=1 217 302 6.0E-08
sp|P0AGG5|THIO2_ECOL6 Thioredoxin-2 OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=trxC PE=3 SV=1 217 302 6.0E-08
sp|P0AGG6|THIO2_ECO57 Thioredoxin-2 OS=Escherichia coli O157:H7 GN=trxC PE=3 SV=1 217 302 6.0E-08
sp|Q6NRT6|DJC10_XENLA DnaJ homolog subfamily C member 10 OS=Xenopus laevis GN=dnajc10 PE=2 SV=1 236 321 7.0E-08
sp|P27773|PDIA3_MOUSE Protein disulfide-isomerase A3 OS=Mus musculus GN=Pdia3 PE=1 SV=2 209 318 7.0E-08
sp|D4B2L8|PDI_ARTBC Protein disulfide-isomerase OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02626 PE=3 SV=1 202 342 7.0E-08
sp|Q92249|ERP38_NEUCR Protein disulfide-isomerase erp38 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=erp38 PE=2 SV=2 240 342 7.0E-08
sp|Q9SRG3|PDI12_ARATH Protein disulfide isomerase-like 1-2 OS=Arabidopsis thaliana GN=PDIL1-2 PE=2 SV=1 209 342 7.0E-08
sp|P52589|PDI_WHEAT Protein disulfide-isomerase OS=Triticum aestivum GN=PDI PE=2 SV=1 209 327 7.0E-08
sp|P04785|PDIA1_RAT Protein disulfide-isomerase OS=Rattus norvegicus GN=P4hb PE=1 SV=2 223 336 9.0E-08
sp|Q8JG64|PDIA3_CHICK Protein disulfide-isomerase A3 OS=Gallus gallus GN=PDIA3 PE=2 SV=1 221 310 9.0E-08
sp|P0A4L2|THIO1_NOSSO Thioredoxin-1 OS=Nostoc sp. (strain ATCC 29151 / PCC 7119) GN=trxA PE=1 SV=2 220 305 9.0E-08
sp|P0A4L1|THIO1_NOSS1 Thioredoxin-1 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=trxA PE=3 SV=2 220 305 9.0E-08
sp|Q0Z7W6|TMX1_BOVIN Thioredoxin-related transmembrane protein 1 OS=Bos taurus GN=TMX1 PE=2 SV=1 223 318 9.0E-08
sp|P48384|TRXM_PEA Thioredoxin M-type, chloroplastic OS=Pisum sativum PE=2 SV=1 227 303 9.0E-08
sp|Q9H3N1|TMX1_HUMAN Thioredoxin-related transmembrane protein 1 OS=Homo sapiens GN=TMX1 PE=1 SV=1 223 321 1.0E-07
sp|P23400|TRXM_CHLRE Thioredoxin M-type, chloroplastic OS=Chlamydomonas reinhardtii GN=TRXM PE=1 SV=3 198 305 1.0E-07
sp|Q0E0I1|PDI53_ORYSJ Protein disulfide isomerase-like 5-3 OS=Oryza sativa subsp. japonica GN=PDIL5-3 PE=3 SV=1 240 310 1.0E-07
sp|Q14554|PDIA5_HUMAN Protein disulfide-isomerase A5 OS=Homo sapiens GN=PDIA5 PE=1 SV=1 210 428 1.0E-07
sp|Q5RCH2|PDIA2_PONAB Protein disulfide-isomerase A2 OS=Pongo abelii GN=PDIA2 PE=2 SV=1 240 458 1.0E-07
sp|P87178|YB1D_SCHPO Uncharacterized protein C3D6.13c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC3D6.13c PE=1 SV=1 234 305 2.0E-07
sp|Q17967|PDI1_CAEEL Protein disulfide-isomerase 1 OS=Caenorhabditis elegans GN=pdi-1 PE=3 SV=1 223 318 2.0E-07
sp|P09103|PDIA1_MOUSE Protein disulfide-isomerase OS=Mus musculus GN=P4hb PE=1 SV=2 223 336 2.0E-07
sp|Q5RCH2|PDIA2_PONAB Protein disulfide-isomerase A2 OS=Pongo abelii GN=PDIA2 PE=2 SV=1 222 318 2.0E-07
sp|Q8VX13|PDI13_ARATH Protein disulfide isomerase-like 1-3 OS=Arabidopsis thaliana GN=PDIL1-3 PE=2 SV=1 199 304 2.0E-07
sp|Q13087|PDIA2_HUMAN Protein disulfide-isomerase A2 OS=Homo sapiens GN=PDIA2 PE=1 SV=2 240 458 3.0E-07
sp|Q17424|THIO2_CAEEL Probable thioredoxin-2 OS=Caenorhabditis elegans GN=trx-2 PE=3 SV=2 224 314 3.0E-07
sp|Q8VBT0|TMX1_MOUSE Thioredoxin-related transmembrane protein 1 OS=Mus musculus GN=Tmx1 PE=1 SV=1 210 321 3.0E-07
sp|Q5JMR9|TRXY_ORYSJ Thioredoxin Y, chloroplastic OS=Oryza sativa subsp. japonica GN=Os01g0963400 PE=3 SV=2 204 326 3.0E-07
sp|P80284|PDI_HORVU Protein disulfide-isomerase OS=Hordeum vulgare GN=PDI PE=1 SV=2 209 327 3.0E-07
sp|P52231|THIO_SYNY3 Thioredoxin OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=trxA PE=1 SV=3 227 305 3.0E-07
sp|Q9ZP21|TRXM_WHEAT Thioredoxin M-type, chloroplastic OS=Triticum aestivum PE=2 SV=1 165 305 3.0E-07
sp|P21195|PDIA1_RABIT Protein disulfide-isomerase OS=Oryctolagus cuniculus GN=P4HB PE=2 SV=1 223 331 4.0E-07
sp|P38658|ERP60_SCHMA Probable protein disulfide-isomerase ER-60 OS=Schistosoma mansoni PE=3 SV=1 38 130 4.0E-07
sp|Q8VX13|PDI13_ARATH Protein disulfide isomerase-like 1-3 OS=Arabidopsis thaliana GN=PDIL1-3 PE=2 SV=1 208 310 4.0E-07
sp|P00275|THIO1_CORNE Thioredoxin C-1 OS=Corynebacterium nephridii PE=1 SV=1 220 302 4.0E-07
sp|Q92JR5|THIO_RICCN Thioredoxin OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=trxA PE=3 SV=1 227 305 4.0E-07
sp|Q2KIL5|PDIA5_BOVIN Protein disulfide-isomerase A5 OS=Bos taurus GN=PDIA5 PE=2 SV=1 228 428 4.0E-07
sp|Q4UNK3|THIO_RICFE Thioredoxin OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=trxA PE=3 SV=2 222 305 5.0E-07
sp|P66928|THIO_HELPY Thioredoxin OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=trxA PE=3 SV=1 221 327 5.0E-07
sp|P66929|THIO_HELPJ Thioredoxin OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=trxA PE=3 SV=1 221 327 5.0E-07
sp|O13704|YEU5_SCHPO Thioredoxin domain-containing protein C13F5.05, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC13F5.05 PE=3 SV=2 220 323 5.0E-07
sp|O13811|PDI2_SCHPO Protein disulfide-isomerase C17H9.14c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC17H9.14c PE=3 SV=1 240 353 6.0E-07
sp|D3Z6P0|PDIA2_MOUSE Protein disulfide-isomerase A2 OS=Mus musculus GN=Pdia2 PE=1 SV=1 222 325 7.0E-07
sp|Q9LJU2|PDI53_ARATH Protein disulfide-isomerase 5-3 OS=Arabidopsis thaliana GN=PDIL5-3 PE=2 SV=1 216 301 7.0E-07
sp|P12243|THIO1_SYNE7 Thioredoxin-1 OS=Synechococcus elongatus (strain PCC 7942) GN=trxA PE=3 SV=2 218 305 7.0E-07
sp|Q6H7E4|TRXM1_ORYSJ Thioredoxin M1, chloroplastic OS=Oryza sativa subsp. japonica GN=Os02g0639900 PE=2 SV=1 223 303 7.0E-07
sp|Q9ZP20|TRXM5_ORYSJ Thioredoxin M5, chloroplastic OS=Oryza sativa subsp. japonica GN=TRXM PE=2 SV=1 226 305 8.0E-07
sp|Q921X9|PDIA5_MOUSE Protein disulfide-isomerase A5 OS=Mus musculus GN=Pdia5 PE=1 SV=1 224 428 8.0E-07
sp|Q5I0H9|PDIA5_RAT Protein disulfide-isomerase A5 OS=Rattus norvegicus GN=Pdia5 PE=2 SV=1 224 428 8.0E-07
sp|Q54EN4|PDI2_DICDI Protein disulfide-isomerase 2 OS=Dictyostelium discoideum GN=pdi2 PE=3 SV=1 41 153 9.0E-07
sp|Q6NPF9|TRXY1_ARATH Thioredoxin Y1, chloroplastic OS=Arabidopsis thaliana GN=At1g76760 PE=2 SV=1 224 325 9.0E-07
sp|P21195|PDIA1_RABIT Protein disulfide-isomerase OS=Oryctolagus cuniculus GN=P4HB PE=2 SV=1 38 130 1.0E-06
sp|P12244|GSBP_CHICK Dolichyl-diphosphooligosaccharide--protein glycotransferase OS=Gallus gallus PE=2 SV=2 223 324 1.0E-06
sp|P52588|PDI_MAIZE Protein disulfide-isomerase OS=Zea mays GN=PDI PE=2 SV=1 207 324 1.0E-06
sp|P40557|EPS1_YEAST ER-retained PMA1-suppressing protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=EPS1 PE=1 SV=1 41 122 1.0E-06
sp|P92979|APR1_ARATH 5'-adenylylsulfate reductase 1, chloroplastic OS=Arabidopsis thaliana GN=APR1 PE=1 SV=2 214 298 1.0E-06
sp|Q1RKN1|THIO_RICBR Thioredoxin OS=Rickettsia bellii (strain RML369-C) GN=trxA PE=3 SV=2 219 305 1.0E-06
sp|P50254|THIO_PYRYE Thioredoxin OS=Pyropia yezoensis GN=trxA PE=3 SV=1 219 305 1.0E-06
sp|Q942L2|PDI22_ORYSJ Protein disulfide isomerase-like 2-2 OS=Oryza sativa subsp. japonica GN=PDIL2-2 PE=2 SV=1 28 132 2.0E-06
sp|P08003|PDIA4_MOUSE Protein disulfide-isomerase A4 OS=Mus musculus GN=Pdia4 PE=1 SV=3 34 152 2.0E-06
sp|Q12730|PDI_ASPNG Protein disulfide-isomerase OS=Aspergillus niger GN=pdiA PE=2 SV=1 201 321 2.0E-06
sp|P09102|PDIA1_CHICK Protein disulfide-isomerase OS=Gallus gallus GN=P4HB PE=1 SV=3 223 324 2.0E-06
sp|P07237|PDIA1_HUMAN Protein disulfide-isomerase OS=Homo sapiens GN=P4HB PE=1 SV=3 223 324 2.0E-06
sp|Q2HWU2|PDIA1_MACFU Protein disulfide-isomerase OS=Macaca fuscata fuscata GN=P4HB PE=2 SV=1 223 324 2.0E-06
sp|P05307|PDIA1_BOVIN Protein disulfide-isomerase OS=Bos taurus GN=P4HB PE=1 SV=1 223 324 2.0E-06
sp|Q13087|PDIA2_HUMAN Protein disulfide-isomerase A2 OS=Homo sapiens GN=PDIA2 PE=1 SV=2 222 318 2.0E-06
sp|Q9FF55|PDI14_ARATH Protein disulfide isomerase-like 1-4 OS=Arabidopsis thaliana GN=PDIL1-4 PE=1 SV=1 210 304 2.0E-06
sp|P92980|APR3_ARATH 5'-adenylylsulfate reductase 3, chloroplastic OS=Arabidopsis thaliana GN=APR3 PE=2 SV=2 201 298 2.0E-06
sp|P37395|THIO_CYACA Thioredoxin OS=Cyanidium caldarium GN=trxA PE=3 SV=1 221 305 2.0E-06
sp|Q9XI01|PDI11_ARATH Protein disulfide isomerase-like 1-1 OS=Arabidopsis thaliana GN=PDIL1-1 PE=1 SV=1 209 327 2.0E-06
sp|Q9X2T1|THIO_PSEAE Thioredoxin OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=trxA PE=3 SV=1 221 309 2.0E-06
sp|Q69SA9|PDI54_ORYSJ Protein disulfide isomerase-like 5-4 OS=Oryza sativa subsp. japonica GN=PDIL5-4 PE=2 SV=1 241 301 2.0E-06
sp|Q8NBS9|TXND5_HUMAN Thioredoxin domain-containing protein 5 OS=Homo sapiens GN=TXNDC5 PE=1 SV=2 38 149 3.0E-06
sp|P38659|PDIA4_RAT Protein disulfide-isomerase A4 OS=Rattus norvegicus GN=Pdia4 PE=1 SV=2 34 152 3.0E-06
sp|Q29RV1|PDIA4_BOVIN Protein disulfide-isomerase A4 OS=Bos taurus GN=PDIA4 PE=2 SV=1 34 152 3.0E-06
sp|Q5R5B6|PDIA1_PONAB Protein disulfide-isomerase OS=Pongo abelii GN=P4HB PE=2 SV=1 223 324 3.0E-06
sp|P38657|PDIA3_BOVIN Protein disulfide-isomerase A3 OS=Bos taurus GN=PDIA3 PE=2 SV=1 38 138 3.0E-06
sp|Q9XF61|PDI_DATGL Protein disulfide-isomerase OS=Datisca glomerata GN=PDI PE=2 SV=1 209 320 3.0E-06
sp|P09103|PDIA1_MOUSE Protein disulfide-isomerase OS=Mus musculus GN=P4hb PE=1 SV=2 38 130 4.0E-06
sp|O48737|TRXM1_ARATH Thioredoxin M1, chloroplastic OS=Arabidopsis thaliana GN=At1g03680 PE=2 SV=1 227 305 4.0E-06
sp|D3Z6P0|PDIA2_MOUSE Protein disulfide-isomerase A2 OS=Mus musculus GN=Pdia2 PE=1 SV=1 202 458 5.0E-06
sp|P51225|THIO_PORPU Thioredoxin OS=Porphyra purpurea GN=trxA PE=3 SV=1 219 305 5.0E-06
sp|Q8R4U2|PDIA1_CRIGR Protein disulfide-isomerase OS=Cricetulus griseus GN=P4HB PE=2 SV=1 223 320 6.0E-06
sp|Q91W90|TXND5_MOUSE Thioredoxin domain-containing protein 5 OS=Mus musculus GN=Txndc5 PE=1 SV=2 38 149 7.0E-06
sp|P0AA30|THIO_SHIFL Thioredoxin-1 OS=Shigella flexneri GN=trxA PE=3 SV=2 221 302 7.0E-06
sp|P0AA28|THIO_SALTY Thioredoxin-1 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=trxA PE=3 SV=2 221 302 7.0E-06
sp|P0AA29|THIO_SALTI Thioredoxin-1 OS=Salmonella typhi GN=trxA PE=3 SV=2 221 302 7.0E-06
sp|P0AA25|THIO_ECOLI Thioredoxin-1 OS=Escherichia coli (strain K12) GN=trxA PE=1 SV=2 221 302 7.0E-06
sp|P0AA26|THIO_ECOL6 Thioredoxin-1 OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=trxA PE=3 SV=2 221 302 7.0E-06
sp|P0AA27|THIO_ECO57 Thioredoxin-1 OS=Escherichia coli O157:H7 GN=trxA PE=1 SV=2 221 302 7.0E-06
sp|P55059|PDI_HUMIN Protein disulfide-isomerase OS=Humicola insolens PE=1 SV=1 201 321 8.0E-06
sp|Q5RDG4|PDIA3_PONAB Protein disulfide-isomerase A3 OS=Pongo abelii GN=PDIA3 PE=2 SV=1 38 138 8.0E-06
sp|P30101|PDIA3_HUMAN Protein disulfide-isomerase A3 OS=Homo sapiens GN=PDIA3 PE=1 SV=4 38 138 8.0E-06
sp|Q4VIT4|PDIA3_CHLAE Protein disulfide-isomerase A3 OS=Chlorocebus aethiops GN=PDIA3 PE=2 SV=1 38 138 8.0E-06
sp|P17967|PDI_YEAST Protein disulfide-isomerase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDI1 PE=1 SV=2 215 337 8.0E-06
sp|Q9ZEE0|THIO_RICPR Thioredoxin OS=Rickettsia prowazekii (strain Madrid E) GN=trxA PE=3 SV=2 222 305 8.0E-06
sp|P27773|PDIA3_MOUSE Protein disulfide-isomerase A3 OS=Mus musculus GN=Pdia3 PE=1 SV=2 38 138 9.0E-06
sp|P11598|PDIA3_RAT Protein disulfide-isomerase A3 OS=Rattus norvegicus GN=Pdia3 PE=1 SV=2 38 151 9.0E-06
sp|Q7X8R5|TRXM2_ORYSJ Thioredoxin M2, chloroplastic OS=Oryza sativa subsp. japonica GN=Os04g0530600 PE=2 SV=2 223 303 1.0E-05
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

Domain # Start End Length
1 620 642 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2081
MRLLALALVLGAAVPAWAQDADPLPESTTFNSVTVPPLLDLTPSNWEQETKKSRWLVVKHYSPYCHHCKEFAPRY
QTLYEYYYTSKADDGAPLLKSYDVQFAIINCIRYSDLCEEHSVQRYPTTVVFEKGIKFDAIEGNQKMPAVSKLIE
KALDKERPGSRPKELALPEAGAKESPPSNPSPDKPDDKETPVDPPKAKADKPSATSNDKPLSTANPNGVSVSLTA
ESFQKLVTMTQDPWFIKLYAPWCHHCQALQPTWEQLAKSMQGKLHIGEVNCEKESALCKKDLNVKMYPTIMFFKG
GERTEYSGLRGLGDFVQYAEEAMQLAGGVPDVDAEELKKLEQKHDVIFVYFYDHATTSEDFKALERLPLSLIGHA
KLVKTKDRKLYDRFKITTWPRLLVSREGRPTYYPPLTPDEMRDVRGVLEWMKSVWLPLVPELSPSNARQIMDGKL
VVLGVLNHDDHDAFQASLREMKSAANEWMDRQLQEFQLERKKLRDSKQMRIEEAEDRNDQRALRAAKAIRVNMDN
SGRKEVMFAWVDGVYWQRWIRTTYGIDVKDGERIIINDEDNRRYWDQTVTGNHMLVSRTSIMETLDKIVYGPNVI
KPKLTISAPEKMLLDIRIALMEHPLLALGCVVGITFGVVSWIRGRNRRRGGHFRLDDSMGIKELKDGLLGGNGNH
KAD*
Coding >Ophun1|2081
ATGAGGCTTCTCGCCCTCGCTCTGGTCTTAGGGGCCGCTGTCCCTGCCTGGGCGCAGGATGCCGACCCTCTGCCC
GAGAGCACCACCTTCAACTCCGTCACCGTCCCTCCGCTACTCGATCTCACGCCCAGCAACTGGGAGCAAGAGACC
AAGAAGTCGCGATGGCTTGTAGTCAAGCATTATAGCCCCTATTGCCACCATTGCAAGGAATTCGCCCCCAGGTAT
CAAACCCTGTACGAGTATTACTACACGTCGAAAGCCGACGACGGCGCTCCTCTGTTGAAGTCATACGACGTCCAG
TTCGCCATCATCAACTGCATCCGCTATTCCGATCTTTGCGAGGAGCATAGTGTCCAGCGCTATCCCACCACCGTC
GTCTTCGAAAAAGGCATCAAGTTCGACGCTATCGAAGGAAACCAAAAGATGCCCGCCGTCAGCAAACTCATTGAA
AAGGCGTTGGATAAGGAAAGGCCCGGTTCGCGACCCAAAGAATTGGCCCTGCCCGAGGCCGGCGCAAAAGAGTCA
CCGCCGAGCAATCCCTCACCAGACAAGCCCGATGACAAGGAGACACCGGTCGACCCGCCCAAGGCCAAGGCCGAT
AAGCCCTCGGCGACGAGCAACGACAAGCCCCTGTCGACGGCCAATCCCAATGGCGTCTCCGTTTCCCTGACGGCC
GAAAGCTTCCAAAAGTTGGTGACGATGACGCAGGATCCGTGGTTCATCAAGCTCTACGCCCCCTGGTGCCATCAT
TGTCAAGCCCTTCAGCCGACGTGGGAGCAGCTGGCCAAGTCGATGCAGGGCAAGCTCCACATCGGCGAGGTCAAC
TGCGAAAAGGAGTCTGCCCTGTGCAAAAAGGACCTCAACGTCAAGATGTACCCCACTATCATGTTCTTCAAGGGC
GGCGAGCGCACCGAGTACAGCGGCCTCCGTGGTCTGGGCGACTTTGTGCAGTACGCGGAAGAGGCCATGCAGCTG
GCCGGCGGCGTGCCCGATGTCGACGCCGAAGAGCTGAAGAAGCTGGAGCAGAAGCACGACGTCATCTTTGTCTAC
TTTTACGACCACGCGACCACGAGTGAGGACTTTAAGGCGCTCGAGAGGCTGCCGCTGAGCCTCATCGGCCACGCC
AAGCTGGTCAAGACCAAGGACCGCAAGCTTTATGACCGGTTCAAGATTACGACTTGGCCGAGACTCCTGGTGTCG
AGAGAAGGCAGGCCGACGTACTACCCACCGCTGACTCCGGACGAGATGCGCGACGTGCGCGGCGTGCTCGAGTGG
ATGAAGTCGGTATGGCTGCCACTGGTGCCCGAGCTGTCGCCGTCGAACGCTCGGCAGATCATGGACGGCAAGCTC
GTGGTGCTGGGCGTCCTCAACCACGACGACCATGATGCCTTCCAGGCCTCTCTGCGGGAGATGAAGAGCGCCGCC
AACGAGTGGATGGACCGGCAGCTGCAAGAGTTTCAGCTGGAGCGTAAGAAGCTACGCGACTCGAAGCAGATGAGA
ATCGAGGAGGCCGAGGATCGCAACGACCAGAGAGCGCTGAGGGCGGCCAAGGCCATCCGCGTCAACATGGACAAT
TCGGGCCGCAAGGAGGTCATGTTTGCGTGGGTCGATGGCGTCTACTGGCAACGCTGGATCCGAACTACCTACGGA
ATCGACGTCAAGGACGGCGAGCGCATCATCATCAACGACGAAGACAATCGGAGATACTGGGACCAGACGGTGACG
GGCAATCACATGCTCGTGTCGCGTACATCCATCATGGAGACGCTGGACAAGATCGTGTACGGGCCCAACGTGATC
AAGCCCAAGCTGACGATTTCGGCGCCGGAGAAGATGCTGCTGGACATTCGGATAGCGCTCATGGAGCACCCGCTG
CTGGCGCTGGGATGCGTCGTGGGCATCACCTTTGGCGTCGTCTCGTGGATCCGCGGTCGCAACCGCAGACGCGGC
GGGCACTTTCGCCTGGACGACAGCATGGGCATCAAGGAGCTCAAGGACGGACTGCTGGGGGGCAACGGCAACCAC
AAGGCCGACTAA
Transcript >Ophun1|2081
ATGAGGCTTCTCGCCCTCGCTCTGGTCTTAGGGGCCGCTGTCCCTGCCTGGGCGCAGGATGCCGACCCTCTGCCC
GAGAGCACCACCTTCAACTCCGTCACCGTCCCTCCGCTACTCGATCTCACGCCCAGCAACTGGGAGCAAGAGACC
AAGAAGTCGCGATGGCTTGTAGTCAAGCATTATAGCCCCTATTGCCACCATTGCAAGGAATTCGCCCCCAGGTAT
CAAACCCTGTACGAGTATTACTACACGTCGAAAGCCGACGACGGCGCTCCTCTGTTGAAGTCATACGACGTCCAG
TTCGCCATCATCAACTGCATCCGCTATTCCGATCTTTGCGAGGAGCATAGTGTCCAGCGCTATCCCACCACCGTC
GTCTTCGAAAAAGGCATCAAGTTCGACGCTATCGAAGGAAACCAAAAGATGCCCGCCGTCAGCAAACTCATTGAA
AAGGCGTTGGATAAGGAAAGGCCCGGTTCGCGACCCAAAGAATTGGCCCTGCCCGAGGCCGGCGCAAAAGAGTCA
CCGCCGAGCAATCCCTCACCAGACAAGCCCGATGACAAGGAGACACCGGTCGACCCGCCCAAGGCCAAGGCCGAT
AAGCCCTCGGCGACGAGCAACGACAAGCCCCTGTCGACGGCCAATCCCAATGGCGTCTCCGTTTCCCTGACGGCC
GAAAGCTTCCAAAAGTTGGTGACGATGACGCAGGATCCGTGGTTCATCAAGCTCTACGCCCCCTGGTGCCATCAT
TGTCAAGCCCTTCAGCCGACGTGGGAGCAGCTGGCCAAGTCGATGCAGGGCAAGCTCCACATCGGCGAGGTCAAC
TGCGAAAAGGAGTCTGCCCTGTGCAAAAAGGACCTCAACGTCAAGATGTACCCCACTATCATGTTCTTCAAGGGC
GGCGAGCGCACCGAGTACAGCGGCCTCCGTGGTCTGGGCGACTTTGTGCAGTACGCGGAAGAGGCCATGCAGCTG
GCCGGCGGCGTGCCCGATGTCGACGCCGAAGAGCTGAAGAAGCTGGAGCAGAAGCACGACGTCATCTTTGTCTAC
TTTTACGACCACGCGACCACGAGTGAGGACTTTAAGGCGCTCGAGAGGCTGCCGCTGAGCCTCATCGGCCACGCC
AAGCTGGTCAAGACCAAGGACCGCAAGCTTTATGACCGGTTCAAGATTACGACTTGGCCGAGACTCCTGGTGTCG
AGAGAAGGCAGGCCGACGTACTACCCACCGCTGACTCCGGACGAGATGCGCGACGTGCGCGGCGTGCTCGAGTGG
ATGAAGTCGGTATGGCTGCCACTGGTGCCCGAGCTGTCGCCGTCGAACGCTCGGCAGATCATGGACGGCAAGCTC
GTGGTGCTGGGCGTCCTCAACCACGACGACCATGATGCCTTCCAGGCCTCTCTGCGGGAGATGAAGAGCGCCGCC
AACGAGTGGATGGACCGGCAGCTGCAAGAGTTTCAGCTGGAGCGTAAGAAGCTACGCGACTCGAAGCAGATGAGA
ATCGAGGAGGCCGAGGATCGCAACGACCAGAGAGCGCTGAGGGCGGCCAAGGCCATCCGCGTCAACATGGACAAT
TCGGGCCGCAAGGAGGTCATGTTTGCGTGGGTCGATGGCGTCTACTGGCAACGCTGGATCCGAACTACCTACGGA
ATCGACGTCAAGGACGGCGAGCGCATCATCATCAACGACGAAGACAATCGGAGATACTGGGACCAGACGGTGACG
GGCAATCACATGCTCGTGTCGCGTACATCCATCATGGAGACGCTGGACAAGATCGTGTACGGGCCCAACGTGATC
AAGCCCAAGCTGACGATTTCGGCGCCGGAGAAGATGCTGCTGGACATTCGGATAGCGCTCATGGAGCACCCGCTG
CTGGCGCTGGGATGCGTCGTGGGCATCACCTTTGGCGTCGTCTCGTGGATCCGCGGTCGCAACCGCAGACGCGGC
GGGCACTTTCGCCTGGACGACAGCATGGGCATCAAGGAGCTCAAGGACGGACTGCTGGGGGGCAACGGCAACCAC
AAGGCCGACTAA
Gene >Ophun1|2081
ATGAGGCTTCTCGCCCTCGCTCTGGTCTTAGGGGCCGCTGTCCCTGCCTGGGCGCAGGATGCCGACCCTCTGCCC
GAGAGCACCACCTTCAACTCCGTCACCGTCCCTCCGCTACTCGATCTCACGCCCAGCAACTGGGAGCAAGAGACC
AAGAAGTCGCGATGGCTTGTAGTCAAGCATTATAGGTAAGCTCGTCGTCCCCTTCGCCCGTCGCGCCCGCCACTG
ACTTGTCTTGCGACAGCCCCTATTGCCACCATTGCAAGGAATTCGCCCCCAGGTATCAAACCCTGTACGAGTATT
ACTACACGTCGAAAGCCGACGACGGCGCTCCTCTGTTGAAGTCATACGACGTCCAGTTCGCCATCATCAACTGCA
TCCGCTATTCCGATCTTTGCGAGGAGCATAGTGTCCAGCGCTATCCCACCACCGTCGTCTTCGAAAAAGGCATCA
AGTTCGACGCTATCGAAGGAAACCAAAAGATGCCCGCCGTCAGCAAACTCATTGAAAAGGCGTTGGATAAGGAAA
GGCCCGGTTCGCGACCCAAAGAATTGGCCCTGCCCGAGGCCGGCGCAAAAGAGTCACCGCCGAGCAATCCCTCAC
CAGACAAGCCCGATGACAAGGAGACACCGGTCGACCCGCCCAAGGCCAAGGCCGATAAGCCCTCGGCGACGAGCA
ACGACAAGCCCCTGTCGACGGCCAATCCCAATGGCGTCTCCGTTTCCCTGACGGCCGAAAGCTTCCAAAAGTTGG
TGACGATGACGCAGGATCCGTGGTTCATCAAGCTCTACGCCCCCTGGTGCCATCATTGTCAAGCCCTTCAGCCGA
CGTGGGAGCAGCTGGCCAAGTCGATGCAGGGCAAGCTCCACATCGGCGAGGTCAACTGCGAAAAGGAGTCTGCCC
TGTGCAAAAAGGACCTCAACGTCAAGATGTACCCCACTATCATGTTCTTCAAGGGCGGCGAGCGCACCGAGTACA
GCGGCCTCCGTGGTCTGGGCGACTTTGTGCAGTACGCGGAAGAGGCCATGCAGCTGGCCGGCGGCGTGCCCGATG
TCGACGCCGAAGAGCTGAAGAAGCTGGAGCAGAAGCACGACGTCATCTTTGTCTACTTTTACGACCACGCGACCA
CGAGTGAGGACTTTAAGGCGCTCGAGAGGCTGCCGCTGAGCCTCATCGGCCACGCCAAGCTGGTCAAGACCAAGG
ACCGCAAGCTTTATGACCGGTTCAAGATTACGACTTGGCCGAGACTCCTGGTGTCGAGAGAAGGCAGGCCGACGT
ACTACCCACCGCTGACTCCGGACGAGATGCGCGACGTGCGCGGCGTGCTCGAGTGGATGAAGTCGGTATGGCTGC
CACTGGTGCCCGAGCTGTCGCCGTCGAACGCTCGGCAGATCATGGACGGCAAGCTCGTGGTGCTGGGCGTCCTCA
ACCACGACGACCATGATGCCTTCCAGGCCTCTCTGCGGGAGATGAAGAGCGCCGCCAACGAGTGGATGGACCGGC
AGCTGCAAGAGTTTCAGCTGGAGCGTAAGAAGCTACGCGACTCGAAGCAGATGAGAATCGAGGAGGCCGAGGATC
GCAACGACCAGAGAGCGCTGAGGGCGGCCAAGGCCATCCGCGTCAACATGGACAATTCGGGCCGCAAGGAGGTCA
TGTTTGCGTGGGTCGATGGCGTCTACTGGCAACGCTGGATCCGAACTACCTACGGAATCGACGTCAAGGACGGCG
AGCGCATCATCATCAACGACGAAGACGTGAGTGATTCGCTTTCCACGTTGTGTACTGACATTGCTAACGGGTCGG
ACAGAATCGGAGATACTGGGACCAGACGGTGACGGGCAATCACATGCTCGTGTCGCGTACATCCATCATGGAGAC
GCTGGACAAGATCGTGTACGGGCCCAACGTGATCAAGCCCAAGCTGACGATTTCGGCGCCGGAGAAGATGCTGCT
GGACATTCGGATAGCGCTCATGGAGCACCCGCTGCTGGCGCTGGGATGCGTCGTGGGCATCACCTTTGGCGTCGT
CTCGTGGATCCGCGGTCGCAACCGCAGACGCGGCGGGCACTTTCGCCTGGACGACAGCATGGGCATCAAGGAGCT
CAAGGACGGACTGCTGGGGGGCAACGGCAACCACAAGGCCGACTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail