Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2079
Gene name
LocationContig_198:20922..22929
Strand-
Gene length (bp)2007
Transcript length (bp)1869
Coding sequence length (bp)1869
Protein length (aa) 623

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01554 MatE MatE 1.5E-33 191 351
PF01554 MatE MatE 3.5E-20 414 570

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q05497|YD338_YEAST Uncharacterized transporter YDR338C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YDR338C PE=1 SV=1 160 610 3.0E-117
sp|P38767|ERC1_YEAST Ethionine resistance-conferring protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERC1 PE=1 SV=1 79 552 4.0E-107
sp|Q9USK3|YJ2D_SCHPO Uncharacterized transporter C4B3.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC4B3.13 PE=3 SV=1 131 619 1.0E-104
sp|Q9UT92|YL47_SCHPO Uncharacterized transporter C323.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC323.07c PE=1 SV=1 179 618 3.0E-94
sp|Q10085|YAO6_SCHPO Uncharacterized transporter C11D3.06 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC11D3.06 PE=3 SV=1 181 618 2.0E-80
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q05497|YD338_YEAST Uncharacterized transporter YDR338C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YDR338C PE=1 SV=1 160 610 3.0E-117
sp|P38767|ERC1_YEAST Ethionine resistance-conferring protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERC1 PE=1 SV=1 79 552 4.0E-107
sp|Q9USK3|YJ2D_SCHPO Uncharacterized transporter C4B3.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC4B3.13 PE=3 SV=1 131 619 1.0E-104
sp|Q9UT92|YL47_SCHPO Uncharacterized transporter C323.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC323.07c PE=1 SV=1 179 618 3.0E-94
sp|Q10085|YAO6_SCHPO Uncharacterized transporter C11D3.06 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC11D3.06 PE=3 SV=1 181 618 2.0E-80
sp|Q3V050|S47A2_MOUSE Multidrug and toxin extrusion protein 2 OS=Mus musculus GN=Slc47a2 PE=1 SV=1 172 618 6.0E-72
sp|Q5RFD2|S47A1_PONAB Multidrug and toxin extrusion protein 1 OS=Pongo abelii GN=SLC47A1 PE=2 SV=1 176 615 4.0E-66
sp|Q8K0H1|S47A1_MOUSE Multidrug and toxin extrusion protein 1 OS=Mus musculus GN=Slc47a1 PE=1 SV=2 180 615 9.0E-66
sp|A4IIS8|S47A1_XENTR Multidrug and toxin extrusion protein 1 OS=Xenopus tropicalis GN=slc47a1 PE=2 SV=1 200 618 1.0E-63
sp|Q5I0E9|S47A1_RAT Multidrug and toxin extrusion protein 1 OS=Rattus norvegicus GN=Slc47a1 PE=1 SV=1 178 615 2.0E-63
sp|Q96FL8|S47A1_HUMAN Multidrug and toxin extrusion protein 1 OS=Homo sapiens GN=SLC47A1 PE=1 SV=1 176 615 6.0E-62
sp|Q9FHB6|DTX16_ARATH Protein DETOXIFICATION 16 OS=Arabidopsis thaliana GN=DTX16 PE=2 SV=1 175 618 2.0E-58
sp|A7KAU2|S47A1_RABIT Multidrug and toxin extrusion protein 1 OS=Oryctolagus cuniculus GN=SLC47A1 PE=2 SV=1 176 615 4.0E-58
sp|Q5R7E4|S47A2_PONAB Multidrug and toxin extrusion protein 2 OS=Pongo abelii GN=SLC47A2 PE=2 SV=1 181 620 3.0E-56
sp|F4IHU9|DTX15_ARATH Protein DETOXIFICATION 15 OS=Arabidopsis thaliana GN=DTX15 PE=3 SV=1 179 618 8.0E-56
sp|Q86VL8|S47A2_HUMAN Multidrug and toxin extrusion protein 2 OS=Homo sapiens GN=SLC47A2 PE=1 SV=1 181 620 2.0E-55
sp|A1L1P9|S47A1_DANRE Multidrug and toxin extrusion protein 1 OS=Danio rerio GN=slc47a1 PE=2 SV=1 174 618 3.0E-54
sp|Q9C9U1|DTX17_ARATH Protein DETOXIFICATION 17 OS=Arabidopsis thaliana GN=DTX17 PE=2 SV=1 179 618 8.0E-54
sp|A7KAU3|S47A2_RABIT Multidrug and toxin extrusion protein 2 OS=Oryctolagus cuniculus GN=SLC47A2 PE=1 SV=1 175 615 1.0E-51
sp|Q9SZE2|DTX51_ARATH Protein DETOXIFICATION 51 OS=Arabidopsis thaliana GN=DTX51 PE=2 SV=1 181 621 1.0E-50
sp|Q4PSF4|DTX52_ARATH Protein DETOXIFICATION 52 OS=Arabidopsis thaliana GN=DTX52 PE=2 SV=1 176 615 4.0E-49
sp|Q9C994|DTX14_ARATH Protein DETOXIFICATION 14 OS=Arabidopsis thaliana GN=DTX14 PE=3 SV=1 180 618 1.0E-48
sp|Q8GXM8|DTX2_ARATH Protein DETOXIFICATION 2 OS=Arabidopsis thaliana GN=DTX2 PE=2 SV=1 175 618 3.0E-48
sp|Q9C9M8|DTX9_ARATH Protein DETOXIFICATION 9 OS=Arabidopsis thaliana GN=DTX9 PE=2 SV=1 175 618 5.0E-46
sp|Q8VYL8|DTX10_ARATH Protein DETOXIFICATION 10 OS=Arabidopsis thaliana GN=DTX10 PE=2 SV=1 181 620 8.0E-45
sp|Q9ZVH5|DTX53_ARATH Protein DETOXIFICATION 53 OS=Arabidopsis thaliana GN=DTX53 PE=2 SV=1 180 621 1.0E-44
sp|Q9SIA3|DTX4_ARATH Protein DETOXIFICATION 4 OS=Arabidopsis thaliana GN=DTX4 PE=3 SV=2 175 618 1.0E-44
sp|Q9SIA4|DTX3_ARATH Protein DETOXIFICATION 3 OS=Arabidopsis thaliana GN=DTX3 PE=3 SV=1 175 618 2.0E-44
sp|F4HZH9|DTX11_ARATH Protein DETOXIFICATION 11 OS=Arabidopsis thaliana GN=DTX11 PE=3 SV=1 181 620 7.0E-43
sp|Q9SIA5|DTX1_ARATH Protein DETOXIFICATION 1 OS=Arabidopsis thaliana GN=DTX1 PE=2 SV=1 175 618 1.0E-42
sp|F4HQ05|DTX8_ARATH Protein DETOXIFICATION 8 OS=Arabidopsis thaliana GN=DTX8 PE=3 SV=1 199 618 2.0E-41
sp|Q9SLV0|DTX48_ARATH Protein DETOXIFICATION 48 OS=Arabidopsis thaliana GN=DTX48 PE=2 SV=1 180 615 3.0E-41
sp|Q8L731|DTX12_ARATH Protein DETOXIFICATION 12 OS=Arabidopsis thaliana GN=DTX12 PE=2 SV=1 181 620 6.0E-41
sp|Q94AL1|DTX13_ARATH Protein DETOXIFICATION 13 OS=Arabidopsis thaliana GN=DTX13 PE=2 SV=1 181 620 3.0E-40
sp|Q8RWF5|DTX6_ARATH Protein DETOXIFICATION 6 OS=Arabidopsis thaliana GN=DTX6 PE=2 SV=1 175 618 3.0E-40
sp|Q9SAB0|DTX36_ARATH Protein DETOXIFICATION 36 OS=Arabidopsis thaliana GN=DTX36 PE=2 SV=1 181 618 9.0E-40
sp|Q9LE20|DTX54_ARATH Protein DETOXIFICATION 54 OS=Arabidopsis thaliana GN=DTX54 PE=2 SV=1 180 615 1.0E-39
sp|Q9LVD9|DTX40_ARATH Protein DETOXIFICATION 40 OS=Arabidopsis thaliana GN=DTX40 PE=1 SV=1 173 618 2.0E-39
sp|Q9FJ87|DTX50_ARATH Protein DETOXIFICATION 50 OS=Arabidopsis thaliana GN=DTX50 PE=2 SV=1 176 621 3.0E-39
sp|O80695|DTX37_ARATH Protein DETOXIFICATION 37 OS=Arabidopsis thaliana GN=DTX37 PE=2 SV=1 181 618 7.0E-39
sp|Q38956|DTX29_ARATH Protein DETOXIFICATION 29 OS=Arabidopsis thaliana GN=DTX29 PE=1 SV=1 181 618 1.0E-38
sp|Q9SIA1|DTX5_ARATH Protein DETOXIFICATION 5 OS=Arabidopsis thaliana GN=DTX5 PE=3 SV=2 181 618 1.0E-38
sp|Q9LUH3|DTX18_ARATH Protein DETOXIFICATION 18 OS=Arabidopsis thaliana GN=DTX18 PE=2 SV=1 180 592 2.0E-38
sp|Q9LUH2|DTX19_ARATH Protein DETOXIFICATION 19 OS=Arabidopsis thaliana GN=DTX19 PE=2 SV=1 152 592 4.0E-38
sp|Q9LYT3|DTX41_ARATH Protein DETOXIFICATION 41 OS=Arabidopsis thaliana GN=DTX41 PE=2 SV=1 136 618 2.0E-37
sp|O82752|DTX49_ARATH Protein DETOXIFICATION 49 OS=Arabidopsis thaliana GN=DTX49 PE=2 SV=1 180 622 3.0E-37
sp|Q8RXK1|DTX23_ARATH Protein DETOXIFICATION 23 OS=Arabidopsis thaliana GN=DTX23 PE=2 SV=1 135 618 6.0E-37
sp|Q1PFG9|DTX7_ARATH Protein DETOXIFICATION 7 OS=Arabidopsis thaliana GN=DTX7 PE=2 SV=1 183 618 4.0E-36
sp|Q9FH21|DTX55_ARATH Protein DETOXIFICATION 55 OS=Arabidopsis thaliana GN=DTX55 PE=2 SV=1 180 615 4.0E-36
sp|Q940N9|DTX39_ARATH Protein DETOXIFICATION 39 OS=Arabidopsis thaliana GN=DTX39 PE=2 SV=1 181 618 1.0E-35
sp|Q9SX83|DTX33_ARATH Protein DETOXIFICATION 33 OS=Arabidopsis thaliana GN=DTX33 PE=2 SV=1 180 618 1.0E-35
sp|Q9LS19|DTX30_ARATH Protein DETOXIFICATION 30 OS=Arabidopsis thaliana GN=DTX30 PE=2 SV=1 172 618 1.0E-35
sp|Q8W488|DTX21_ARATH Protein DETOXIFICATION 21 OS=Arabidopsis thaliana GN=DTX21 PE=1 SV=1 145 618 7.0E-35
sp|Q9LPV4|DTX31_ARATH Protein DETOXIFICATION 31 OS=Arabidopsis thaliana GN=DTX31 PE=2 SV=1 181 618 1.0E-34
sp|F4JKB9|DTX38_ARATH Protein DETOXIFICATION 38 OS=Arabidopsis thaliana GN=DTX38 PE=2 SV=1 205 618 4.0E-34
sp|F4HPH2|DTX20_ARATH Protein DETOXIFICATION 20 OS=Arabidopsis thaliana GN=DTX20 PE=3 SV=1 150 619 5.0E-34
sp|F4JTB3|DTX35_ARATH Protein DETOXIFICATION 35 OS=Arabidopsis thaliana GN=DTX35 PE=2 SV=1 155 618 4.0E-33
sp|F4HPH1|DTX22_ARATH Protein DETOXIFICATION 22 OS=Arabidopsis thaliana GN=DTX22 PE=2 SV=1 145 619 2.0E-32
sp|F4JH46|DTX34_ARATH Protein DETOXIFICATION 34 OS=Arabidopsis thaliana GN=DTX34 PE=2 SV=1 181 618 7.0E-32
sp|F4I4Q3|DTX32_ARATH Protein DETOXIFICATION 32 OS=Arabidopsis thaliana GN=DTX32 PE=3 SV=1 181 618 8.0E-31
sp|Q9FKQ1|DTX27_ARATH Protein DETOXIFICATION 27 OS=Arabidopsis thaliana GN=DTX27 PE=2 SV=1 181 618 1.0E-30
sp|O49660|DTX56_ARATH Protein DETOXIFICATION 56 OS=Arabidopsis thaliana GN=DTX56 PE=1 SV=1 156 615 1.0E-27
sp|Q1PDX9|DTX26_ARATH Protein DETOXIFICATION 26 OS=Arabidopsis thaliana GN=DTX26 PE=2 SV=1 160 591 7.0E-27
sp|Q8L616|DTX25_ARATH Protein DETOXIFICATION 25 OS=Arabidopsis thaliana GN=DTX25 PE=2 SV=1 152 618 2.0E-26
sp|Q9FNC1|DTX28_ARATH Protein DETOXIFICATION 28 OS=Arabidopsis thaliana GN=DTX28 PE=3 SV=1 142 618 3.0E-24
sp|Q9KEJ2|NORM_BACHD Probable multidrug resistance protein NorM OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=norM PE=3 SV=1 177 597 7.0E-24
sp|Q5KZL2|NORM_GEOKA Probable multidrug resistance protein NorM OS=Geobacillus kaustophilus (strain HTA426) GN=norM PE=3 SV=1 178 598 2.0E-23
sp|Q7MKP8|NORM_VIBVY Multidrug resistance protein NorM OS=Vibrio vulnificus (strain YJ016) GN=norM PE=3 SV=2 178 596 3.0E-23
sp|F4J158|DTX24_ARATH Protein DETOXIFICATION 24 OS=Arabidopsis thaliana GN=DTX24 PE=2 SV=1 201 618 8.0E-23
sp|Q8D9N8|NORM_VIBVU Multidrug resistance protein NorM OS=Vibrio vulnificus (strain CMCP6) GN=norM PE=3 SV=2 178 596 9.0E-23
sp|Q5E4Y6|NORM_VIBF1 Multidrug resistance protein NorM OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=norM PE=3 SV=1 178 598 9.0E-23
sp|Q81T85|NORM_BACAN Probable multidrug resistance protein NorM OS=Bacillus anthracis GN=norM PE=3 SV=1 299 592 2.0E-22
sp|O82855|NORM_VIBPA Multidrug resistance protein NorM OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=norM PE=1 SV=2 178 598 2.0E-22
sp|Q6HLG9|NORM_BACHK Probable multidrug resistance protein NorM OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=norM PE=3 SV=1 299 592 2.0E-22
sp|Q73BB8|NORM_BACC1 Probable multidrug resistance protein NorM OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=norM PE=3 SV=1 299 592 2.0E-22
sp|Q8CUL5|NORM_OCEIH Probable multidrug resistance protein NorM OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=norM PE=3 SV=2 199 597 8.0E-22
sp|Q7WAK9|NORM_BORPA Probable multidrug resistance protein NorM OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=norM PE=3 SV=1 175 607 3.0E-21
sp|Q81G28|NORM_BACCR Probable multidrug resistance protein NorM OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=norM PE=3 SV=1 299 592 3.0E-21
sp|Q7WJR0|NORM_BORBR Probable multidrug resistance protein NorM OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=norM PE=3 SV=1 175 607 3.0E-21
sp|Q8UDF5|NORM_AGRFC Probable multidrug resistance protein NorM OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=norM PE=3 SV=1 167 598 1.0E-20
sp|Q63DZ4|NORM_BACCZ Probable multidrug resistance protein NorM OS=Bacillus cereus (strain ZK / E33L) GN=norM PE=3 SV=1 299 592 2.0E-20
sp|Q9I3Y3|PMPM_PSEAE Multidrug resistance protein PmpM OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=pmpM PE=3 SV=1 181 598 3.0E-20
sp|Q6LQ49|NORM_PHOPR Multidrug resistance protein NorM OS=Photobacterium profundum GN=norM PE=3 SV=1 177 598 7.0E-20
sp|Q8Y654|NORM_LISMO Probable multidrug resistance protein NorM OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=norM PE=3 SV=1 180 598 9.0E-20
sp|Q9KRU4|NORM_VIBCH Multidrug resistance protein NorM OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=norM PE=3 SV=2 178 598 2.0E-19
sp|Q71YH0|NORM_LISMF Probable multidrug resistance protein NorM OS=Listeria monocytogenes serotype 4b (strain F2365) GN=norM PE=3 SV=1 180 598 4.0E-19
sp|Q92AG2|NORM_LISIN Probable multidrug resistance protein NorM OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=norM PE=3 SV=1 180 598 6.0E-19
sp|Q6D5W6|MDTK_PECAS Multidrug resistance protein MdtK OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=mdtK PE=3 SV=1 181 601 7.0E-19
sp|Q7N1G0|NORM_PHOLL Probable multidrug resistance protein NorM OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=norM PE=3 SV=1 176 603 9.0E-18
sp|Q63S57|NORM_BURPS Probable multidrug resistance protein NorM OS=Burkholderia pseudomallei (strain K96243) GN=norM PE=3 SV=1 177 598 2.0E-17
sp|O31855|NORM_BACSU Probable multidrug resistance protein NorM OS=Bacillus subtilis (strain 168) GN=norM PE=3 SV=1 211 597 2.0E-16
sp|Q62LW6|NORM_BURMA Probable multidrug resistance protein NorM OS=Burkholderia mallei (strain ATCC 23344) GN=norM PE=3 SV=1 177 598 2.0E-16
sp|A1JPA1|MDTK_YERE8 Multidrug resistance protein MdtK OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=mdtK PE=3 SV=1 181 598 2.0E-16
sp|Q65IG9|NORM_BACLD Probable multidrug resistance protein NorM OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=norM PE=3 SV=1 179 592 4.0E-16
sp|B4EWN4|MDTK_PROMH Multidrug resistance protein MdtK OS=Proteus mirabilis (strain HI4320) GN=mdtK PE=3 SV=1 180 598 7.0E-16
sp|Q5NYX9|NORM_AROAE Probable multidrug resistance protein NorM OS=Aromatoleum aromaticum (strain EbN1) GN=norM PE=3 SV=1 182 598 1.0E-15
sp|P45272|HMRM_HAEIN Multidrug resistance protein HmrM OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=hmrM PE=3 SV=1 173 598 1.0E-15
sp|A7FHJ7|MDTK_YERP3 Multidrug resistance protein MdtK OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=mdtK PE=3 SV=1 181 598 2.0E-15
sp|B1JJ53|MDTK_YERPY Multidrug resistance protein MdtK OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=mdtK PE=3 SV=1 181 598 2.0E-15
sp|Q66A27|MDTK_YERPS Multidrug resistance protein MdtK OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=mdtK PE=3 SV=1 181 598 2.0E-15
sp|A4TIP9|MDTK_YERPP Multidrug resistance protein MdtK OS=Yersinia pestis (strain Pestoides F) GN=mdtK PE=3 SV=1 181 598 2.0E-15
sp|Q1CIK5|MDTK_YERPN Multidrug resistance protein MdtK OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=mdtK PE=3 SV=1 181 598 2.0E-15
sp|A9QZC0|MDTK_YERPG Multidrug resistance protein MdtK OS=Yersinia pestis bv. Antiqua (strain Angola) GN=mdtK PE=3 SV=1 181 598 2.0E-15
sp|Q8ZDZ8|MDTK_YERPE Multidrug resistance protein MdtK OS=Yersinia pestis GN=mdtK PE=3 SV=1 181 598 2.0E-15
sp|B2K5I9|MDTK_YERPB Multidrug resistance protein MdtK OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=mdtK PE=3 SV=1 181 598 2.0E-15
sp|Q1C769|MDTK_YERPA Multidrug resistance protein MdtK OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=mdtK PE=3 SV=1 181 598 2.0E-15
sp|Q8G2I1|NORM_BRUSU Probable multidrug resistance protein NorM OS=Brucella suis biovar 1 (strain 1330) GN=norM PE=3 SV=1 178 616 5.0E-15
sp|Q8YFD7|NORM_BRUME Probable multidrug resistance protein NorM OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=norM PE=3 SV=1 178 616 5.0E-15
sp|C5BDY7|MDTK_EDWI9 Multidrug resistance protein MdtK OS=Edwardsiella ictaluri (strain 93-146) GN=mdtK PE=3 SV=1 178 598 9.0E-15
sp|Q7WTR3|MDTK_ERWAM Multidrug resistance protein MdtK OS=Erwinia amylovora GN=mdtK PE=3 SV=1 181 598 2.0E-14
sp|Q6FEY7|NORM_ACIAD Probable multidrug resistance protein NorM OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=norM PE=3 SV=1 181 592 2.0E-14
sp|Q6NB79|NORM_RHOPA Probable multidrug resistance protein NorM OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=norM PE=3 SV=1 176 610 2.0E-14
sp|Q9F5N7|NORM_BURVI Multidrug resistance protein NorM OS=Burkholderia vietnamiensis GN=norM PE=3 SV=1 273 598 3.0E-14
sp|A7MFC3|MDTK_CROS8 Multidrug resistance protein MdtK OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=mdtK PE=3 SV=1 181 598 6.0E-14
sp|Q89W72|NORM_BRADU Probable multidrug resistance protein NorM OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=norM PE=3 SV=1 189 591 6.0E-14
sp|Q88CB9|NORM_PSEPK Probable multidrug resistance protein NorM OS=Pseudomonas putida (strain KT2440) GN=norM PE=3 SV=1 296 597 8.0E-14
sp|Q98D15|NORM_RHILO Probable multidrug resistance protein NorM OS=Rhizobium loti (strain MAFF303099) GN=norM PE=3 SV=1 178 608 2.0E-13
sp|Q9JV27|NORM_NEIMA Probable multidrug resistance protein NorM OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=norM PE=3 SV=1 176 597 2.0E-13
sp|Q9CMZ9|NORM_PASMU Probable multidrug resistance protein NorM OS=Pasteurella multocida (strain Pm70) GN=norM PE=3 SV=1 199 596 3.0E-13
sp|A4W9T2|MDTK_ENT38 Multidrug resistance protein MdtK OS=Enterobacter sp. (strain 638) GN=mdtK PE=3 SV=1 178 598 4.0E-13
sp|Q9K015|NORM_NEIMB Probable multidrug resistance protein NorM OS=Neisseria meningitidis serogroup B (strain MC58) GN=norM PE=3 SV=1 180 597 7.0E-13
sp|Q7VMB5|NORM_HAEDU Probable multidrug resistance protein NorM OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=norM PE=3 SV=1 174 574 1.0E-12
sp|Q7N3V2|MDTK_PHOLL Multidrug resistance protein MdtK OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=mdtK PE=3 SV=1 180 600 2.0E-12
sp|A9MEJ6|MDTK_SALAR Multidrug resistance protein MdtK OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=mdtK PE=3 SV=1 178 598 3.0E-12
sp|Q92PZ0|NORM_RHIME Probable multidrug resistance protein NorM OS=Rhizobium meliloti (strain 1021) GN=norM PE=3 SV=1 176 575 3.0E-12
sp|B4TH65|MDTK_SALHS Multidrug resistance protein MdtK OS=Salmonella heidelberg (strain SL476) GN=mdtK PE=3 SV=1 178 598 5.0E-12
sp|B4T562|MDTK_SALNS Multidrug resistance protein MdtK OS=Salmonella newport (strain SL254) GN=mdtK PE=3 SV=1 178 598 5.0E-12
sp|Q8Z6N7|MDTK_SALTI Multidrug resistance protein MdtK OS=Salmonella typhi GN=mdtK PE=3 SV=1 178 598 7.0E-12
sp|C0Q5V7|MDTK_SALPC Multidrug resistance protein MdtK OS=Salmonella paratyphi C (strain RKS4594) GN=mdtK PE=3 SV=1 178 598 7.0E-12
sp|B5FIH8|MDTK_SALDC Multidrug resistance protein MdtK OS=Salmonella dublin (strain CT_02021853) GN=mdtK PE=3 SV=1 178 598 7.0E-12
sp|Q8EES3|NORM_SHEON Probable multidrug resistance protein NorM OS=Shewanella oneidensis (strain MR-1) GN=norM PE=3 SV=1 181 610 7.0E-12
sp|B5RAN4|MDTK_SALG2 Multidrug resistance protein MdtK OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=mdtK PE=3 SV=1 178 598 7.0E-12
sp|B5QV34|MDTK_SALEP Multidrug resistance protein MdtK OS=Salmonella enteritidis PT4 (strain P125109) GN=mdtK PE=3 SV=1 178 598 7.0E-12
sp|B4TUY3|MDTK_SALSV Multidrug resistance protein MdtK OS=Salmonella schwarzengrund (strain CVM19633) GN=mdtK PE=3 SV=1 178 598 8.0E-12
sp|A9N0Y8|MDTK_SALPB Multidrug resistance protein MdtK OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=mdtK PE=3 SV=1 178 598 8.0E-12
sp|B5F6M2|MDTK_SALA4 Multidrug resistance protein MdtK OS=Salmonella agona (strain SL483) GN=mdtK PE=3 SV=1 178 598 8.0E-12
sp|B5BKE4|MDTK_SALPK Multidrug resistance protein MdtK OS=Salmonella paratyphi A (strain AKU_12601) GN=mdtK PE=3 SV=1 178 598 8.0E-12
sp|Q5PH16|MDTK_SALPA Multidrug resistance protein MdtK OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=mdtK PE=3 SV=1 178 598 8.0E-12
sp|Q57PL1|MDTK_SALCH Multidrug resistance protein MdtK OS=Salmonella choleraesuis (strain SC-B67) GN=mdtK PE=3 SV=1 178 598 8.0E-12
sp|Q8ZPP2|MDTK_SALTY Multidrug resistance protein MdtK OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=mdtK PE=3 SV=1 178 598 1.0E-11
sp|Q5QWR6|NORM_IDILO Probable multidrug resistance protein NorM OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=norM PE=3 SV=1 191 596 1.0E-11
sp|Q9PA34|NORM_XYLFA Probable multidrug resistance protein NorM OS=Xylella fastidiosa (strain 9a5c) GN=norM PE=3 SV=1 405 598 2.0E-11
sp|A8AH48|MDTK_CITK8 Multidrug resistance protein MdtK OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=mdtK PE=3 SV=1 181 598 2.0E-11
sp|Q879Z5|NORM_XYLFT Probable multidrug resistance protein NorM OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=norM PE=3 SV=1 405 598 3.0E-11
sp|Q8DPQ6|NORM_STRR6 Probable multidrug resistance protein NorM OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=norM PE=3 SV=1 175 593 3.0E-11
sp|Q0T4A9|MDTK_SHIF8 Multidrug resistance protein MdtK OS=Shigella flexneri serotype 5b (strain 8401) GN=mdtK PE=3 SV=1 181 598 3.0E-11
sp|B5XWL3|MDTK_KLEP3 Multidrug resistance protein MdtK OS=Klebsiella pneumoniae (strain 342) GN=mdtK PE=3 SV=1 181 598 4.0E-11
sp|B7LQA4|MDTK_ESCF3 Multidrug resistance protein MdtK OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=mdtK PE=3 SV=1 180 598 5.0E-11
sp|Q9RY44|NORM_DEIRA Probable multidrug resistance protein NorM OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=norM PE=3 SV=1 181 592 6.0E-11
sp|Q7UAH8|MDTK_SHIFL Multidrug resistance protein MdtK OS=Shigella flexneri GN=mdtK PE=3 SV=1 181 598 1.0E-10
sp|A6TA11|MDTK_KLEP7 Multidrug resistance protein MdtK OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=mdtK PE=3 SV=1 181 598 1.0E-10
sp|B1IQ91|MDTK_ECOLC Multidrug resistance protein MdtK OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=mdtK PE=3 SV=1 181 598 1.0E-10
sp|A8A0L0|MDTK_ECOHS Multidrug resistance protein MdtK OS=Escherichia coli O9:H4 (strain HS) GN=mdtK PE=3 SV=1 181 598 1.0E-10
sp|B5Z497|MDTK_ECO5E Multidrug resistance protein MdtK OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=mdtK PE=3 SV=1 181 598 1.0E-10
sp|P58164|MDTK_ECO57 Multidrug resistance protein MdtK OS=Escherichia coli O157:H7 GN=mdtK PE=3 SV=1 181 598 1.0E-10
sp|P37340|MDTK_ECOLI Multidrug resistance protein MdtK OS=Escherichia coli (strain K12) GN=mdtK PE=1 SV=2 181 598 2.0E-10
sp|Q0THG4|MDTK_ECOL5 Multidrug resistance protein MdtK OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=mdtK PE=3 SV=1 181 598 2.0E-10
sp|B1XFX3|MDTK_ECODH Multidrug resistance protein MdtK OS=Escherichia coli (strain K12 / DH10B) GN=mdtK PE=3 SV=1 181 598 2.0E-10
sp|C4ZYC7|MDTK_ECOBW Multidrug resistance protein MdtK OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=mdtK PE=3 SV=1 181 598 2.0E-10
sp|B7MV43|MDTK_ECO81 Multidrug resistance protein MdtK OS=Escherichia coli O81 (strain ED1a) GN=mdtK PE=3 SV=1 181 598 2.0E-10
sp|B7US04|MDTK_ECO27 Multidrug resistance protein MdtK OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=mdtK PE=3 SV=1 181 598 2.0E-10
sp|Q3Z218|MDTK_SHISS Multidrug resistance protein MdtK OS=Shigella sonnei (strain Ss046) GN=mdtK PE=3 SV=1 181 598 2.0E-10
sp|Q321C2|MDTK_SHIBS Multidrug resistance protein MdtK OS=Shigella boydii serotype 4 (strain Sb227) GN=mdtK PE=3 SV=1 181 598 2.0E-10
sp|B1LEM1|MDTK_ECOSM Multidrug resistance protein MdtK OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=mdtK PE=3 SV=1 181 598 2.0E-10
sp|B7NBB6|MDTK_ECOLU Multidrug resistance protein MdtK OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=mdtK PE=3 SV=1 181 598 2.0E-10
sp|Q1RBD2|MDTK_ECOUT Multidrug resistance protein MdtK OS=Escherichia coli (strain UTI89 / UPEC) GN=mdtK PE=3 SV=1 181 598 2.0E-10
sp|Q8FH68|MDTK_ECOL6 Multidrug resistance protein MdtK OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=mdtK PE=3 SV=1 181 598 2.0E-10
sp|A1ABK4|MDTK_ECOK1 Multidrug resistance protein MdtK OS=Escherichia coli O1:K1 / APEC GN=mdtK PE=3 SV=1 181 598 2.0E-10
sp|B7MA17|MDTK_ECO45 Multidrug resistance protein MdtK OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=mdtK PE=3 SV=1 181 598 2.0E-10
sp|B2U2G8|MDTK_SHIB3 Multidrug resistance protein MdtK OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=mdtK PE=3 SV=1 181 598 2.0E-10
sp|B7M0M0|MDTK_ECO8A Multidrug resistance protein MdtK OS=Escherichia coli O8 (strain IAI1) GN=mdtK PE=3 SV=1 181 598 2.0E-10
sp|B7NTX0|MDTK_ECO7I Multidrug resistance protein MdtK OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=mdtK PE=3 SV=1 181 598 2.0E-10
sp|B7L5L6|MDTK_ECO55 Multidrug resistance protein MdtK OS=Escherichia coli (strain 55989 / EAEC) GN=mdtK PE=3 SV=1 181 598 2.0E-10
sp|A7ZMC9|MDTK_ECO24 Multidrug resistance protein MdtK OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=mdtK PE=3 SV=1 181 598 2.0E-10
sp|B6IBA3|MDTK_ECOSE Multidrug resistance protein MdtK OS=Escherichia coli (strain SE11) GN=mdtK PE=3 SV=1 181 598 2.0E-10
sp|Q65SY9|NORM_MANSM Probable multidrug resistance protein NorM OS=Mannheimia succiniciproducens (strain MBEL55E) GN=norM PE=3 SV=1 199 600 2.0E-10
sp|Q7NXN3|NORM_CHRVO Probable multidrug resistance protein NorM OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=norM PE=3 SV=1 181 604 4.0E-10
sp|Q89AX2|NORM_BUCBP Probable multidrug resistance protein NorM OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=norM PE=3 SV=1 180 597 2.0E-09
sp|Q32FA7|MDTK_SHIDS Multidrug resistance protein MdtK OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=mdtK PE=3 SV=1 181 598 2.0E-09
sp|Q55364|NORM_SYNY3 Probable multidrug resistance protein NorM OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=norM PE=3 SV=1 174 597 5.0E-09
sp|Q97QN5|NORM_STRPN Probable multidrug resistance protein NorM OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=norM PE=3 SV=1 175 594 2.0E-08
sp|Q88BA2|NORM_PSESM Probable multidrug resistance protein NorM OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=norM PE=3 SV=1 237 597 8.0E-08
sp|Q8PG07|NORM_XANAC Probable multidrug resistance protein NorM OS=Xanthomonas axonopodis pv. citri (strain 306) GN=norM PE=3 SV=1 405 598 2.0E-07
sp|Q9HTR0|NORM_PSEAE Probable multidrug resistance protein NorM OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=norM PE=3 SV=1 181 575 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0015297 antiporter activity Yes
GO:0016020 membrane Yes
GO:0042910 xenobiotic transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0051179 localization No
GO:0022857 transmembrane transporter activity No
GO:0005215 transporter activity No
GO:0051234 establishment of localization No
GO:0003674 molecular_function No
GO:0008150 biological_process No
GO:0009987 cellular process No
GO:0005575 cellular_component No
GO:0006810 transport No
GO:0110165 cellular anatomical entity No
GO:0015291 secondary active transmembrane transporter activity No
GO:0022804 active transmembrane transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 13 0.45

Transmembrane Domains

Domain # Start End Length
1 186 208 22
2 218 240 22
3 267 284 17
4 299 318 19
5 331 353 22
6 363 385 22
7 484 506 22
8 516 538 22
9 559 578 19
10 582 604 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2079
MDRHRPTHSPNRGSPARPPMLSDSPLADDIAACSDSDDDALIVPGHSMYRRPSGVAYGTARPVFNDQQPMQEPFL
TPIERKQSRDAERSLLRDNRVLPPKHPVKSQTLPARLYRRLFSTRVPPGIDADGAPDGRISRQPATERTSLLPDG
SDDALTDGDELEQQWEEAVASGRLRTTWQREAQTVFAYSVPLIVTFFLQYSISVASVFAVGRIGRLELGAVSVAS
MTMSVTCLAPFMGLATSLDTLCAQAYGSGHKQLVGLQCQRMVAFLSTLAAPIAILWLFSDRLLVHIVPDAESARL
ASQYLKIMILAIPSIIVFETGKRFLQAQGLFRATTLVLLIAAPINILINWLLVWKLGLGFIGAPIAVVITENLLP
LLLVLYVIFIDGSQCWGGFSRRALTNWWPMVKLALPGMIMIEAEWMAFEAMTLISSRFGTEYLAAQSALMTLATI
SYQIPFPVSIAASTRVANLIGAGMVDAARTTAKVTFAAVCLVGMINLIIYSTLRFRLPMLFTQDEAVIAIVAKTL
PVVAVVQVFDGLSAGAHGLLRGIGKQRIGGPANLVAYYAIALPIALGLAFGAGWKLIGMWSGLIVGLVTVAIIEY
TYLLLTDWHQSAVEAAARNAAG*
Coding >Ophun1|2079
ATGGATCGCCATCGACCGACTCACTCGCCCAACCGCGGCTCCCCCGCTCGTCCGCCCATGCTATCGGACTCGCCC
CTGGCCGATGACATCGCCGCCTGCTCCGACTCCGACGATGACGCCTTGATCGTCCCCGGCCACTCCATGTATCGC
CGGCCCAGCGGCGTCGCTTACGGCACCGCCCGGCCCGTCTTCAACGACCAGCAGCCCATGCAGGAGCCCTTCCTG
ACGCCCATCGAGAGGAAGCAGTCCCGTGACGCCGAGCGCAGTCTCCTGCGGGACAATCGCGTCCTGCCGCCCAAG
CATCCGGTCAAGAGCCAGACGCTGCCGGCCCGCCTCTACCGACGCCTCTTCAGCACCCGCGTCCCGCCCGGCATC
GACGCCGACGGCGCCCCGGATGGCCGCATCTCCCGACAACCGGCGACGGAACGCACCTCGCTGCTCCCCGACGGC
TCCGACGACGCCCTCACCGATGGCGACGAGCTCGAGCAGCAGTGGGAAGAGGCCGTAGCCTCGGGCCGGCTGCGC
ACCACCTGGCAGCGTGAAGCCCAGACCGTCTTCGCCTACTCGGTGCCCCTCATCGTCACCTTCTTCCTCCAGTAC
TCCATCAGCGTGGCCAGCGTCTTCGCCGTCGGTAGGATCGGCCGCCTCGAGCTGGGCGCCGTATCTGTCGCCTCC
ATGACCATGTCGGTGACGTGCCTGGCCCCCTTTATGGGGCTGGCCACGAGCCTCGACACGCTGTGCGCACAGGCC
TACGGGTCCGGGCACAAGCAGCTCGTCGGGCTCCAGTGCCAGCGCATGGTGGCCTTTCTCTCCACGCTGGCTGCC
CCAATCGCCATTCTCTGGCTCTTTTCCGACCGCCTCCTGGTGCACATTGTGCCCGATGCCGAATCGGCCCGGCTG
GCGAGCCAGTATCTGAAGATTATGATCCTGGCCATTCCGAGCATCATCGTCTTCGAGACGGGCAAGCGCTTCCTC
CAGGCGCAGGGCCTCTTCAGGGCCACGACGTTGGTCTTGCTCATAGCAGCTCCCATCAACATCTTGATCAACTGG
CTCTTGGTCTGGAAGCTGGGCCTGGGCTTCATCGGCGCCCCAATCGCCGTCGTCATCACGGAGAATCTACTGCCG
TTGCTCTTAGTGCTTTACGTCATCTTCATCGACGGCTCCCAGTGCTGGGGAGGCTTCAGCAGGCGAGCTCTGACC
AACTGGTGGCCCATGGTCAAGCTGGCCTTGCCTGGGATGATTATGATTGAGGCCGAATGGATGGCCTTTGAGGCT
ATGACGCTAATCTCTAGCCGATTCGGCACCGAGTATCTGGCGGCACAGAGCGCTCTCATGACGCTGGCGACGATA
TCCTACCAAATACCGTTTCCCGTGTCCATTGCGGCATCGACGAGAGTGGCGAATCTCATTGGGGCCGGCATGGTG
GATGCGGCGCGGACAACGGCCAAAGTGACATTCGCAGCCGTGTGTCTAGTGGGCATGATCAACCTCATCATCTAC
AGCACCTTGCGGTTCCGACTGCCCATGCTCTTCACCCAAGACGAGGCCGTCATCGCCATCGTGGCCAAAACGCTA
CCGGTCGTGGCCGTGGTCCAGGTCTTTGACGGGCTTAGTGCCGGCGCCCACGGCCTGTTGCGAGGGATCGGCAAG
CAGAGGATCGGCGGACCGGCCAACCTGGTGGCCTACTATGCCATTGCGCTGCCCATCGCTCTGGGACTGGCCTTT
GGCGCCGGATGGAAGCTGATTGGCATGTGGTCCGGTCTGATCGTTGGTCTTGTTACCGTCGCTATTATCGAGTAT
ACGTATCTGCTCCTGACGGACTGGCATCAATCCGCTGTCGAGGCGGCGGCGAGGAACGCGGCTGGTTAA
Transcript >Ophun1|2079
ATGGATCGCCATCGACCGACTCACTCGCCCAACCGCGGCTCCCCCGCTCGTCCGCCCATGCTATCGGACTCGCCC
CTGGCCGATGACATCGCCGCCTGCTCCGACTCCGACGATGACGCCTTGATCGTCCCCGGCCACTCCATGTATCGC
CGGCCCAGCGGCGTCGCTTACGGCACCGCCCGGCCCGTCTTCAACGACCAGCAGCCCATGCAGGAGCCCTTCCTG
ACGCCCATCGAGAGGAAGCAGTCCCGTGACGCCGAGCGCAGTCTCCTGCGGGACAATCGCGTCCTGCCGCCCAAG
CATCCGGTCAAGAGCCAGACGCTGCCGGCCCGCCTCTACCGACGCCTCTTCAGCACCCGCGTCCCGCCCGGCATC
GACGCCGACGGCGCCCCGGATGGCCGCATCTCCCGACAACCGGCGACGGAACGCACCTCGCTGCTCCCCGACGGC
TCCGACGACGCCCTCACCGATGGCGACGAGCTCGAGCAGCAGTGGGAAGAGGCCGTAGCCTCGGGCCGGCTGCGC
ACCACCTGGCAGCGTGAAGCCCAGACCGTCTTCGCCTACTCGGTGCCCCTCATCGTCACCTTCTTCCTCCAGTAC
TCCATCAGCGTGGCCAGCGTCTTCGCCGTCGGTAGGATCGGCCGCCTCGAGCTGGGCGCCGTATCTGTCGCCTCC
ATGACCATGTCGGTGACGTGCCTGGCCCCCTTTATGGGGCTGGCCACGAGCCTCGACACGCTGTGCGCACAGGCC
TACGGGTCCGGGCACAAGCAGCTCGTCGGGCTCCAGTGCCAGCGCATGGTGGCCTTTCTCTCCACGCTGGCTGCC
CCAATCGCCATTCTCTGGCTCTTTTCCGACCGCCTCCTGGTGCACATTGTGCCCGATGCCGAATCGGCCCGGCTG
GCGAGCCAGTATCTGAAGATTATGATCCTGGCCATTCCGAGCATCATCGTCTTCGAGACGGGCAAGCGCTTCCTC
CAGGCGCAGGGCCTCTTCAGGGCCACGACGTTGGTCTTGCTCATAGCAGCTCCCATCAACATCTTGATCAACTGG
CTCTTGGTCTGGAAGCTGGGCCTGGGCTTCATCGGCGCCCCAATCGCCGTCGTCATCACGGAGAATCTACTGCCG
TTGCTCTTAGTGCTTTACGTCATCTTCATCGACGGCTCCCAGTGCTGGGGAGGCTTCAGCAGGCGAGCTCTGACC
AACTGGTGGCCCATGGTCAAGCTGGCCTTGCCTGGGATGATTATGATTGAGGCCGAATGGATGGCCTTTGAGGCT
ATGACGCTAATCTCTAGCCGATTCGGCACCGAGTATCTGGCGGCACAGAGCGCTCTCATGACGCTGGCGACGATA
TCCTACCAAATACCGTTTCCCGTGTCCATTGCGGCATCGACGAGAGTGGCGAATCTCATTGGGGCCGGCATGGTG
GATGCGGCGCGGACAACGGCCAAAGTGACATTCGCAGCCGTGTGTCTAGTGGGCATGATCAACCTCATCATCTAC
AGCACCTTGCGGTTCCGACTGCCCATGCTCTTCACCCAAGACGAGGCCGTCATCGCCATCGTGGCCAAAACGCTA
CCGGTCGTGGCCGTGGTCCAGGTCTTTGACGGGCTTAGTGCCGGCGCCCACGGCCTGTTGCGAGGGATCGGCAAG
CAGAGGATCGGCGGACCGGCCAACCTGGTGGCCTACTATGCCATTGCGCTGCCCATCGCTCTGGGACTGGCCTTT
GGCGCCGGATGGAAGCTGATTGGCATGTGGTCCGGTCTGATCGTTGGTCTTGTTACCGTCGCTATTATCGAGTAT
ACGTATCTGCTCCTGACGGACTGGCATCAATCCGCTGTCGAGGCGGCGGCGAGGAACGCGGCTGGTTAA
Gene >Ophun1|2079
ATGGATCGCCATCGACCGACTCACTCGCCCAACCGCGGCTCCCCCGCTCGTCCGCCCATGCTATCGGACTCGCCC
CTGGCCGATGACATCGCCGCCTGCTCCGACTCCGACGATGACGCCTTGATCGTCCCCGGCCACTCCATGTATCGC
CGGCCCAGCGGCGTCGCTTACGGCACCGCCCGGCCCGTCTTCAACGACCAGCAGCCCATGCAGGAGCCCTTCCTG
ACGCCCATCGAGAGGAAGCAGTCCCGTGACGCCGAGCGCAGTCTCCTGCGGGACAATCGCGTCCTGCCGCCCAAG
CATCCGGTCAAGAGCCAGACGCTGCCGGCCCGCCTCTACCGACGCCTCTTCAGCACCCGCGTCCCGCCCGGCATC
GACGCCGACGGCGCCCCGGATGGCCGCATCTCCCGACAACCGGCGACGGAACGCACCTCGCTGCTCCCCGACGGC
TCCGACGACGCCCTCACCGATGGCGACGAGCTCGAGCAGCAGTGGGAAGAGGCCGTAGCCTCGGGCCGGCTGCGC
ACCACCTGGCAGCGTGAAGCCCAGACCGTCTTCGCCTACTCGGTGCCCCTCATCGTCACCTTCTTCCTCCAGTAC
TCCATCAGCGTGGCCAGCGTCTTCGCCGTCGGTAGGATCGGCCGCCTCGAGCTGGGCGCCGTATCTGTCGCCTCC
ATGACCATGTCGGTGACGTGCCTGGCCCCCTTTATGGGGCTGGCCACGAGCCTCGACACGCTGTGCGCACAGGCC
TACGGGTCCGGGCACAAGCAGCTCGTCGGGCTCCAGTGCCAGCGCATGGTGGCCTTTCTCTCCACGCTGGCTGCC
CCAATCGCCATTCTCTGGCTCTTTTCCGACCGCCTCCTGGTGCACATTGTGCCCGATGCCGAATCGGCCCGGCTG
GCGAGCCAGTATCTGAAGATTATGATCCTGGCCATTCCGAGCATCATCGTCTTCGAGACGGGCAAGCGCTTCCTC
CAGGCGCAGGGCCTCTTCAGGGCCACGACGTTGGTCTTGCTCATAGCAGCTCCCATCAACATCTTGATCAACTGG
CTCTTGGTCTGGAAGCTGGGCCTGGGCTTCATCGGCGCCCCAATCGCCGTCGTCATCACGGAGAATCTACTGCCG
TTGCTCTTAGTGCTTTACGTCATCTTCATCGACGGCTCCCAGTGCTGGGGAGGCTTCAGCAGGCGAGCTCTGACC
AACTGGTGGCCCATGGTCAAGCTGGCCTTGCCTGGGATGATTATGATTGAGGCCGAATGGATGGCCTTTGAGGCT
ATGACGCTAATCTCTAGCCGATTCGGCACCGAGTATCTGGCGGCACAGAGCGCTCTCATGACGCTGGCGACGATA
TCCTACCAAATACCGTTTCCCGTGTCCATTGCGGCATCGACGAGAGTGGCGAATCTCATTGGGGCCGGCATGGTG
GATGCGGCGCGGACAACGGCCAAAGTGGTAGGTCTCGTGGACAAGAGGATGTGGACAAGAGGATTGTCAAGAGAA
CCGTCTAGAGGCTGACCAGAGACGACGCGTGATAGACATTCGCAGCCGTGTGTCTAGTGGGCATGATCAACCTCA
TCATCTACAGCACCTTGCGGTTCCGACTGCCCATGCTCTTCACCCAAGACGAGGCCGTCATCGCCATCGTGGCCA
AAACGCTACCGGTCGTGGCCGTGGTCCAGGTCTTTGACGGGCTTAGTGCCGGCGCCCACGGCCTGTTGCGAGGGA
TCGGCAAGCAGAGGATCGGCGGACCGGCCAACCTGGTGGCCTACTATGCCATTGCGCTGCCCATCGCTCTGGGAC
TGGCCTTTGGCGCCGGATGGAAGCTGATTGGCATGTGGTCCGGTCTGATCGTTGGTCTTGTTACGTGAGTCGTCC
CTCGGGTTTGGGGGTGGTTGACAGCGAGGACTGACGATGAACAGCGTCGCTATTATCGAGTATACGTATCTGCTC
CTGACGGACTGGCATCAATCCGCTGTCGAGGCGGCGGCGAGGAACGCGGCTGGTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail