Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2070
Gene name
LocationContig_197:26080..26824
Strand+
Gene length (bp)744
Transcript length (bp)561
Coding sequence length (bp)561
Protein length (aa) 187

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05730 CFEM CFEM domain 8.9E-14 16 84

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|D4AZC5|CFMA_ARTBC GPI-anchored CFEM domain protein ARB_01545 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01545 PE=1 SV=2 1 87 4.0E-09
sp|Q4WLB9|CFMA_ASPFU GPI-anchored CFEM domain protein A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cfmA PE=1 SV=1 21 66 1.0E-07

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 16 0.999699

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1045
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3793
Ophiocordyceps australis map64 (Brazil) OphauB2|1010
Ophiocordyceps camponoti-floridani Ophcf2|05694
Ophiocordyceps camponoti-rufipedis Ophun1|2070 (this protein)
Ophiocordyceps kimflemingae Ophio5|3256
Ophiocordyceps kimflemingae Ophio5|5795
Ophiocordyceps subramaniannii Hirsu2|9741

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2070
MKSAIFAVSLAAAAVAQNLPQCPTDCLNSMNTQKAQSLGCQNNDFKCLCTKQNWVFGIRDCVAEACNNGQLVVDA
LNDAKNTCAQNGVQIDVNGINTSAGGPTTTDVVVATTVATPATTVATVFSTFSSGGSLTSTPLVTTTIGAQTTTT
VTAGSTTSTSRGFAAQVTAAPAAGMLAAAGLAALMI*
Coding >Ophun1|2070
ATGAAGTCCGCCATCTTCGCCGTCTCTCTGGCTGCTGCCGCTGTCGCCCAGAACCTTCCTCAGTGCCCGACGGAC
TGCCTCAACAGCATGAACACGCAGAAGGCCCAGTCGCTCGGCTGCCAGAACAACGACTTCAAGTGCCTCTGCACC
AAGCAGAACTGGGTCTTTGGTATCCGCGACTGCGTTGCTGAGGCCTGCAACAACGGCCAGCTCGTCGTTGACGCC
CTCAACGACGCCAAGAACACCTGCGCCCAGAACGGTGTTCAGATCGACGTCAACGGCATCAACACGTCGGCCGGC
GGCCCCACCACCACTGATGTTGTTGTTGCCACCACTGTCGCTACCCCCGCCACGACTGTCGCAACCGTCTTCAGC
ACCTTTTCGTCGGGCGGCTCGCTCACCTCGACGCCCCTCGTCACCACGACGATTGGCGCTCAGACTACCACGACG
GTCACTGCCGGCTCCACGACGTCTACCAGCCGCGGCTTCGCCGCTCAGGTTACGGCCGCCCCCGCCGCCGGCATG
CTCGCCGCCGCCGGTCTCGCCGCCCTCATGATCTAG
Transcript >Ophun1|2070
ATGAAGTCCGCCATCTTCGCCGTCTCTCTGGCTGCTGCCGCTGTCGCCCAGAACCTTCCTCAGTGCCCGACGGAC
TGCCTCAACAGCATGAACACGCAGAAGGCCCAGTCGCTCGGCTGCCAGAACAACGACTTCAAGTGCCTCTGCACC
AAGCAGAACTGGGTCTTTGGTATCCGCGACTGCGTTGCTGAGGCCTGCAACAACGGCCAGCTCGTCGTTGACGCC
CTCAACGACGCCAAGAACACCTGCGCCCAGAACGGTGTTCAGATCGACGTCAACGGCATCAACACGTCGGCCGGC
GGCCCCACCACCACTGATGTTGTTGTTGCCACCACTGTCGCTACCCCCGCCACGACTGTCGCAACCGTCTTCAGC
ACCTTTTCGTCGGGCGGCTCGCTCACCTCGACGCCCCTCGTCACCACGACGATTGGCGCTCAGACTACCACGACG
GTCACTGCCGGCTCCACGACGTCTACCAGCCGCGGCTTCGCCGCTCAGGTTACGGCCGCCCCCGCCGCCGGCATG
CTCGCCGCCGCCGGTCTCGCCGCCCTCATGATCTAG
Gene >Ophun1|2070
ATGAAGTCCGCCATCTTCGCCGTCTCTCTGGCTGCTGCCGCTGTCGCCCAGAACCTTCCTCAGTGCCCGGTACGT
CGTCTCCATTCGCGTGCATTTTCACCTGCCGCCCCGCTGACGGCAACCTTCAGACGGACTGCCTCAACAGCATGA
ACACGCAGAAGGCCCAGTCGCTCGGCTGCCAGAACAACGACTTCAAGTGCCTCTGCACCAAGCAGAACTGGGTCT
TTGGTATCCGCGACTGCGTTGCTGAGGCCTGCAACAACGGCCAGCTCGTCGTTGACGCCCTCAACGACGCCAAGA
ACACCTGCGCCCAGAACGGTGTTCAGATCGACGTCAACGGCATCAACACGTCGGCCGGCGGCCCCACCGTATGTC
TTTGCCCTCGACTCACGCAACGGCTCGCTCGCTAACTACCTATGCGTCACAGACCACTGATGTTGTTGTTGCCAC
CACTGTCGCTACCCCCGCCACGACTGTCGCAACCGTCTTCAGCACCTTTTCGTCGGGCGGCTCGCTCACCTCGAC
GCCCCTCGTCACCACGACGATTGGCGCTCAGACTACCACGACGGTCACTGCCGGCTCCACGACGTCTACCAGCCG
CGGCTTCGCCGTGAGTAATGGCCTCAAAAGTGCCGACGTCAAGGGACTCGATGCTGACAAGGTCTCTCTCTGCAG
GCTCAGGTTACGGCCGCCCCCGCCGCCGGCATGCTCGCCGCCGCCGGTCTCGCCGCCCTCATGATCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail