Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2060
Gene name
LocationContig_197:1044..2226
Strand+
Gene length (bp)1182
Transcript length (bp)1182
Coding sequence length (bp)1182
Protein length (aa) 394

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00173 Cyt-b5 Cytochrome b5-like Heme/Steroid binding domain 1.2E-17 10 82
PF04116 FA_hydroxylase Fatty acid hydroxylase 5.7E-09 224 385

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q03529|SCS7_YEAST Ceramide very long chain fatty acid hydroxylase SCS7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SCS7 PE=1 SV=1 3 389 1.0E-127
sp|O13846|SCS7_SCHPO Ceramide very long chain fatty acid hydroxylase-like protein C19G12.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC19G12.08 PE=3 SV=1 19 386 9.0E-98
sp|Q9SUC5|FAH2_ARATH Fatty acid 2-hydroxylase 2 OS=Arabidopsis thaliana GN=FAH2 PE=1 SV=1 140 385 7.0E-45
sp|Q2LAM0|FA2H_RAT Fatty acid 2-hydroxylase OS=Rattus norvegicus GN=Fa2h PE=1 SV=2 8 385 1.0E-43
sp|O48916|FAH1_ARATH Fatty acid 2-hydroxylase 1 OS=Arabidopsis thaliana GN=FAH1 PE=1 SV=1 140 385 1.0E-42
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q03529|SCS7_YEAST Ceramide very long chain fatty acid hydroxylase SCS7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SCS7 PE=1 SV=1 3 389 1.0E-127
sp|O13846|SCS7_SCHPO Ceramide very long chain fatty acid hydroxylase-like protein C19G12.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC19G12.08 PE=3 SV=1 19 386 9.0E-98
sp|Q9SUC5|FAH2_ARATH Fatty acid 2-hydroxylase 2 OS=Arabidopsis thaliana GN=FAH2 PE=1 SV=1 140 385 7.0E-45
sp|Q2LAM0|FA2H_RAT Fatty acid 2-hydroxylase OS=Rattus norvegicus GN=Fa2h PE=1 SV=2 8 385 1.0E-43
sp|O48916|FAH1_ARATH Fatty acid 2-hydroxylase 1 OS=Arabidopsis thaliana GN=FAH1 PE=1 SV=1 140 385 1.0E-42
sp|Q7L5A8|FA2H_HUMAN Fatty acid 2-hydroxylase OS=Homo sapiens GN=FA2H PE=1 SV=1 13 385 3.0E-42
sp|Q4R4P4|FA2H_MACFA Fatty acid 2-hydroxylase OS=Macaca fascicularis GN=FA2H PE=2 SV=1 13 385 4.0E-42
sp|Q5MPP0|FA2H_MOUSE Fatty acid 2-hydroxylase OS=Mus musculus GN=Fa2h PE=1 SV=1 8 385 7.0E-42
sp|P49098|CYB5_TOBAC Cytochrome b5 OS=Nicotiana tabacum PE=2 SV=1 10 99 3.0E-12
sp|O04354|CYB5_BOROF Cytochrome b5 OS=Borago officinalis PE=2 SV=1 10 86 6.0E-12
sp|O48845|CYB5B_ARATH Cytochrome b5 isoform B OS=Arabidopsis thaliana GN=CYTB5-B PE=1 SV=1 10 84 8.0E-12
sp|P49099|CYB5S_TOBAC Cytochrome b5, seed isoform OS=Nicotiana tabacum PE=2 SV=1 10 86 1.0E-11
sp|Q9ZWT2|CYB5D_ARATH Cytochrome B5 isoform D OS=Arabidopsis thaliana GN=CYTB5-D PE=1 SV=1 10 99 2.0E-11
sp|P49097|CYB5_CUSRE Cytochrome b5 OS=Cuscuta reflexa PE=2 SV=1 12 99 2.0E-11
sp|P49100|CYB5_ORYSJ Cytochrome b5 OS=Oryza sativa subsp. japonica GN=Os05g0108800 PE=2 SV=2 1 99 4.0E-11
sp|Q9V4N3|CYB5_DROME Cytochrome b5 OS=Drosophila melanogaster GN=Cyt-b5 PE=2 SV=1 1 111 1.0E-10
sp|O94391|CYB51_SCHPO Probable cytochrome b5 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC29A10.16c PE=3 SV=1 13 82 2.0E-10
sp|P49096|CYB5_MUSDO Cytochrome b5 OS=Musca domestica GN=Cyt-b5 PE=1 SV=1 1 111 2.0E-10
sp|Q42342|CYB5E_ARATH Cytochrome b5 isoform E OS=Arabidopsis thaliana GN=CYTB5-E PE=1 SV=2 3 99 8.0E-10
sp|Q9HFV1|CYB5_RHIST Cytochrome b5 OS=Rhizopus stolonifer PE=2 SV=1 13 82 1.0E-09
sp|Q9FDW8|CYB5A_ARATH Cytochrome b5 isoform A OS=Arabidopsis thaliana GN=CB5-A PE=1 SV=1 6 82 1.0E-09
sp|P11832|NIA1_ARATH Nitrate reductase [NADH] 1 OS=Arabidopsis thaliana GN=NIA1 PE=1 SV=3 12 139 1.0E-09
sp|Q9Y706|CYB5_MORAP Cytochrome b5 OS=Mortierella alpina PE=1 SV=1 6 109 1.0E-09
sp|P40934|CYB5_BRAOB Cytochrome b5 OS=Brassica oleracea var. botrytis GN=CYB5 PE=1 SV=1 13 100 1.0E-09
sp|P11035|NIA2_ARATH Nitrate reductase [NADH] 2 OS=Arabidopsis thaliana GN=NIA2 PE=1 SV=1 5 139 8.0E-09
sp|Q9P5L0|CYB5_NEUCR Probable cytochrome b5 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=B23L21.190 PE=3 SV=2 10 100 1.0E-08
sp|P39867|NIA1_BRANA Nitrate reductase [NADH], clone PBNBR1405 OS=Brassica napus GN=NIA1 PE=2 SV=1 12 139 1.0E-08
sp|P39870|NIA2_SOYBN Inducible nitrate reductase [NADH] 2 OS=Glycine max GN=INR2 PE=2 SV=1 5 139 2.0E-08
sp|Q9Y1W0|FAD5A_DICDI Delta(5) fatty acid desaturase A OS=Dictyostelium discoideum GN=fadA PE=1 SV=1 12 86 3.0E-08
sp|P39868|NIA2_BRANA Nitrate reductase [NADH], clone PBNBR1412 OS=Brassica napus GN=NIA2 PE=2 SV=1 12 139 5.0E-08
sp|P36859|NIA_PETHY Nitrate reductase [NADH] OS=Petunia hybrida GN=NIA PE=2 SV=1 12 139 1.0E-07
sp|Q9USM6|CYB52_SCHPO Probable cytochrome b5 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=oca8 PE=3 SV=1 8 82 1.0E-07
sp|P49102|NIA3_MAIZE Nitrate reductase [NADH] 3 OS=Zea mays PE=3 SV=1 3 139 1.0E-07
sp|P54233|NIA1_SOYBN Inducible nitrate reductase [NADH] 1 OS=Glycine max GN=INR1 PE=2 SV=1 5 139 2.0E-07
sp|Q874I5|CYB5_CANTR Cytochrome b5 OS=Candida tropicalis GN=Cytb5 PE=3 SV=1 10 90 2.0E-07
sp|P36841|NIA_VOLCA Nitrate reductase [NADH] OS=Volvox carteri GN=NITA PE=2 SV=1 10 114 2.0E-07
sp|O22704|CYP5F_ARATH Cytochrome B5-like protein OS=Arabidopsis thaliana GN=CB5LP PE=2 SV=1 8 82 2.0E-07
sp|Q01170|NIA_CHLVU Nitrate reductase [NADH] (Fragment) OS=Chlorella vulgaris PE=2 SV=1 8 110 4.0E-07
sp|Q10352|YDAA_SCHPO Uncharacterized protein C1F12.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1F12.10c PE=3 SV=1 9 84 4.0E-07
sp|P23312|NIA_SPIOL Nitrate reductase [NADH] OS=Spinacia oleracea GN=NIA PE=2 SV=1 12 139 4.0E-07
sp|P43101|NIA_CICIN Nitrate reductase [NADH] OS=Cichorium intybus GN=NIA PE=2 SV=1 8 82 4.0E-07
sp|Q9CQX2|CYB5B_MOUSE Cytochrome b5 type B OS=Mus musculus GN=Cyb5b PE=1 SV=1 13 99 4.0E-07
sp|P16081|NIA1_ORYSJ Nitrate reductase [NADH] 1 OS=Oryza sativa subsp. japonica GN=NIA1 PE=2 SV=3 10 139 6.0E-07
sp|P00171|CYB5_BOVIN Cytochrome b5 OS=Bos taurus GN=CYB5A PE=1 SV=3 3 82 7.0E-07
sp|Q8X0J4|CYB5L_NEUCR Putative cytochrome b5 B11H24.095 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=B11H24.095 PE=3 SV=1 8 63 8.0E-07
sp|P00172|CYB5_PIG Cytochrome b5 OS=Sus scrofa GN=CYB5A PE=1 SV=3 10 82 1.0E-06
sp|P04166|CYB5B_RAT Cytochrome b5 type B OS=Rattus norvegicus GN=Cyb5b PE=1 SV=2 13 84 1.0E-06
sp|P00174|CYB5_CHICK Cytochrome b5 OS=Gallus gallus GN=CYB5A PE=1 SV=4 13 100 1.0E-06
sp|O96099|FAD5B_DICDI Acyl-lipid (8-3)-desaturase B OS=Dictyostelium discoideum GN=fadB PE=1 SV=1 6 86 1.0E-06
sp|P56395|CYB5_MOUSE Cytochrome b5 OS=Mus musculus GN=Cyb5a PE=1 SV=2 10 82 2.0E-06
sp|Q5REA7|FADS2_PONAB Fatty acid desaturase 2 OS=Pongo abelii GN=FADS2 PE=2 SV=1 5 85 2.0E-06
sp|O95864|FADS2_HUMAN Fatty acid desaturase 2 OS=Homo sapiens GN=FADS2 PE=1 SV=1 5 85 2.0E-06
sp|P27783|NIA_BETPN Nitrate reductase [NAD(P)H] OS=Betula pendula GN=NIA1 PE=2 SV=1 12 95 2.0E-06
sp|P39869|NIA_LOTJA Nitrate reductase [NADH] OS=Lotus japonicus GN=NIA PE=3 SV=1 12 82 2.0E-06
sp|P00173|CYB5_RAT Cytochrome b5 OS=Rattus norvegicus GN=Cyb5a PE=1 SV=2 10 82 2.0E-06
sp|P17569|NIA_CUCMA Nitrate reductase [NADH] OS=Cucurbita maxima PE=2 SV=1 8 82 2.0E-06
sp|P82291|CYB5_ECTSH Soluble cytochrome b558 OS=Ectothiorhodospira shaposhnikovii PE=1 SV=2 5 82 2.0E-06
sp|P07850|SUOX_CHICK Sulfite oxidase OS=Gallus gallus GN=SUOX PE=1 SV=3 7 127 3.0E-06
sp|P39865|NIA1_PHAVU Nitrate reductase [NADH] 1 OS=Phaseolus vulgaris GN=NIA1 PE=3 SV=1 12 82 3.0E-06
sp|P32953|CYBL_RHOGR (S)-mandelate dehydrogenase, mitochondrial OS=Rhodotorula graminis PE=1 SV=2 8 84 3.0E-06
sp|P00167|CYB5_HUMAN Cytochrome b5 OS=Homo sapiens GN=CYB5A PE=1 SV=2 10 82 3.0E-06
sp|P39866|NIA2_PHAVU Nitrate reductase [NADH] 2 OS=Phaseolus vulgaris GN=NIA2 PE=3 SV=1 12 139 3.0E-06
sp|P08509|NIA2_TOBAC Nitrate reductase [NADH] 2 OS=Nicotiana tabacum GN=NIA2 PE=2 SV=2 12 106 3.0E-06
sp|O43169|CYB5B_HUMAN Cytochrome b5 type B OS=Homo sapiens GN=CYB5B PE=1 SV=2 13 104 4.0E-06
sp|P00170|CYB5_HORSE Cytochrome b5 OS=Equus caballus GN=CYB5A PE=1 SV=3 10 82 4.0E-06
sp|P27969|NIA2_HORVU Nitrate reductase [NADH] (Fragment) OS=Hordeum vulgare PE=2 SV=1 10 139 4.0E-06
sp|P27967|NIA1_HORVU Nitrate reductase [NADH] OS=Hordeum vulgare PE=3 SV=1 10 139 5.0E-06
sp|Q5RDJ5|CYB5B_PONAB Cytochrome b5 type B OS=Pongo abelii GN=CYB5B PE=2 SV=2 13 105 5.0E-06
sp|P00168|CYB5_ALOSE Cytochrome b5 (Fragment) OS=Alouatta seniculus GN=CYB5A PE=1 SV=2 10 82 5.0E-06
sp|Q5UR80|CYB5L_MIMIV Cytochrome b5-like protein OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L628 PE=3 SV=1 13 76 7.0E-06
sp|P17570|NIA_SOLLC Nitrate reductase [NADH] OS=Solanum lycopersicum GN=NIA PE=3 SV=1 12 139 7.0E-06
sp|P51687|SUOX_HUMAN Sulfite oxidase, mitochondrial OS=Homo sapiens GN=SUOX PE=1 SV=2 10 99 9.0E-06
sp|Q9ZNV4|CYB5C_ARATH Cytochrome B5 isoform C OS=Arabidopsis thaliana GN=CYTB5-C PE=1 SV=1 13 117 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0005506 iron ion binding Yes
GO:0008610 lipid biosynthetic process Yes
GO:1901576 organic substance biosynthetic process No
GO:0046914 transition metal ion binding No
GO:0044238 primary metabolic process No
GO:0005488 binding No
GO:0043167 ion binding No
GO:0006629 lipid metabolic process No
GO:0043169 cation binding No
GO:0003824 catalytic activity No
GO:0071704 organic substance metabolic process No
GO:0009058 biosynthetic process No
GO:0008150 biological_process No
GO:0008152 metabolic process No
GO:0003674 molecular_function No
GO:0046872 metal ion binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

Domain # Start End Length
1 191 213 22
2 220 242 22
3 294 316 22
4 323 345 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2060
MPSRTLPTLTRAEVQSHDSASSCYVTIGSKVFDVTDFLADHPGGPDLILEYAGKDVEDILQDYASHPHSEAAYEV
LDDSLVGFVASPKAVVPAANGVAPVPVKTDPGSVPSVHPRTGMSCEDDLSKETDYSQDYKKHKFLDLGKPLFPQV
WYGGFSKEFYLDQVHRPRHYKGGKSAPLFGNFLEPLTKTPWWLIPTIWLPCVAYGTYLASQGYYGPAATASFWAF
GLFLWTLVEYGMHRFLFHVDEYVQARPTLRGVSLANIEYSYLPDNRVGITAHFLLHGVHHYLPMDKYRLVMPPVL
FVVLATPFWRLAHFLLSFDWHAATAVFCGGIFGYICYDLTHYFLHHQNLPLWYKQLKKYHLQHHFLDYELGFGVT
SKFWDTVFGTELQPIKMK*
Coding >Ophun1|2060
ATGCCTTCGAGGACGCTCCCGACGCTGACTCGCGCCGAGGTGCAATCGCACGACTCTGCCTCGTCGTGCTACGTC
ACCATCGGCTCCAAGGTCTTCGATGTCACCGACTTCCTCGCCGATCATCCCGGCGGGCCCGACCTCATCCTCGAA
TATGCCGGCAAGGACGTCGAGGATATCCTCCAGGACTACGCGTCGCACCCACACTCTGAGGCCGCCTACGAGGTT
CTCGACGACTCCTTGGTTGGCTTCGTTGCCTCACCAAAGGCCGTTGTTCCCGCTGCAAACGGCGTGGCTCCGGTG
CCCGTCAAGACCGACCCCGGCTCCGTCCCCTCCGTCCACCCGCGCACCGGCATGTCGTGTGAGGATGATTTATCT
AAAGAGACCGACTACAGCCAGGACTATAAGAAGCACAAGTTTCTTGACCTCGGAAAGCCTCTCTTCCCCCAAGTC
TGGTACGGCGGGTTCAGCAAAGAATTCTACCTAGACCAGGTTCACCGTCCACGCCACTACAAGGGTGGCAAGTCG
GCGCCCTTATTCGGCAACTTCCTCGAGCCGCTCACCAAGACCCCGTGGTGGTTGATTCCGACTATCTGGCTGCCA
TGTGTCGCATACGGCACCTATCTAGCCTCACAAGGCTACTACGGACCCGCGGCCACGGCCTCTTTCTGGGCGTTT
GGCCTCTTTCTTTGGACGCTTGTAGAGTACGGCATGCATCGGTTTCTGTTCCACGTGGATGAGTACGTTCAGGCC
CGACCAACTCTTCGGGGCGTTTCTTTGGCTAATATTGAATACAGCTACCTGCCCGATAACAGGGTTGGCATCACG
GCGCACTTTCTGCTGCACGGCGTCCATCACTACCTCCCGATGGACAAATATCGCCTGGTGATGCCGCCCGTCCTC
TTTGTCGTCCTGGCGACTCCATTCTGGCGTCTCGCCCATTTTCTTCTGTCCTTCGATTGGCACGCAGCTACGGCC
GTCTTCTGCGGCGGCATCTTCGGCTACATCTGTTACGACCTGACACACTACTTTCTGCACCATCAAAACCTTCCT
CTGTGGTACAAGCAACTCAAGAAGTACCACTTGCAGCATCACTTCCTGGATTACGAACTGGGATTCGGGGTCACG
AGCAAGTTCTGGGACACCGTCTTCGGCACAGAGCTGCAGCCCATCAAGATGAAGTAG
Transcript >Ophun1|2060
ATGCCTTCGAGGACGCTCCCGACGCTGACTCGCGCCGAGGTGCAATCGCACGACTCTGCCTCGTCGTGCTACGTC
ACCATCGGCTCCAAGGTCTTCGATGTCACCGACTTCCTCGCCGATCATCCCGGCGGGCCCGACCTCATCCTCGAA
TATGCCGGCAAGGACGTCGAGGATATCCTCCAGGACTACGCGTCGCACCCACACTCTGAGGCCGCCTACGAGGTT
CTCGACGACTCCTTGGTTGGCTTCGTTGCCTCACCAAAGGCCGTTGTTCCCGCTGCAAACGGCGTGGCTCCGGTG
CCCGTCAAGACCGACCCCGGCTCCGTCCCCTCCGTCCACCCGCGCACCGGCATGTCGTGTGAGGATGATTTATCT
AAAGAGACCGACTACAGCCAGGACTATAAGAAGCACAAGTTTCTTGACCTCGGAAAGCCTCTCTTCCCCCAAGTC
TGGTACGGCGGGTTCAGCAAAGAATTCTACCTAGACCAGGTTCACCGTCCACGCCACTACAAGGGTGGCAAGTCG
GCGCCCTTATTCGGCAACTTCCTCGAGCCGCTCACCAAGACCCCGTGGTGGTTGATTCCGACTATCTGGCTGCCA
TGTGTCGCATACGGCACCTATCTAGCCTCACAAGGCTACTACGGACCCGCGGCCACGGCCTCTTTCTGGGCGTTT
GGCCTCTTTCTTTGGACGCTTGTAGAGTACGGCATGCATCGGTTTCTGTTCCACGTGGATGAGTACGTTCAGGCC
CGACCAACTCTTCGGGGCGTTTCTTTGGCTAATATTGAATACAGCTACCTGCCCGATAACAGGGTTGGCATCACG
GCGCACTTTCTGCTGCACGGCGTCCATCACTACCTCCCGATGGACAAATATCGCCTGGTGATGCCGCCCGTCCTC
TTTGTCGTCCTGGCGACTCCATTCTGGCGTCTCGCCCATTTTCTTCTGTCCTTCGATTGGCACGCAGCTACGGCC
GTCTTCTGCGGCGGCATCTTCGGCTACATCTGTTACGACCTGACACACTACTTTCTGCACCATCAAAACCTTCCT
CTGTGGTACAAGCAACTCAAGAAGTACCACTTGCAGCATCACTTCCTGGATTACGAACTGGGATTCGGGGTCACG
AGCAAGTTCTGGGACACCGTCTTCGGCACAGAGCTGCAGCCCATCAAGATGAAGTAG
Gene >Ophun1|2060
ATGCCTTCGAGGACGCTCCCGACGCTGACTCGCGCCGAGGTGCAATCGCACGACTCTGCCTCGTCGTGCTACGTC
ACCATCGGCTCCAAGGTCTTCGATGTCACCGACTTCCTCGCCGATCATCCCGGCGGGCCCGACCTCATCCTCGAA
TATGCCGGCAAGGACGTCGAGGATATCCTCCAGGACTACGCGTCGCACCCACACTCTGAGGCCGCCTACGAGGTT
CTCGACGACTCCTTGGTTGGCTTCGTTGCCTCACCAAAGGCCGTTGTTCCCGCTGCAAACGGCGTGGCTCCGGTG
CCCGTCAAGACCGACCCCGGCTCCGTCCCCTCCGTCCACCCGCGCACCGGCATGTCGTGTGAGGATGATTTATCT
AAAGAGACCGACTACAGCCAGGACTATAAGAAGCACAAGTTTCTTGACCTCGGAAAGCCTCTCTTCCCCCAAGTC
TGGTACGGCGGGTTCAGCAAAGAATTCTACCTAGACCAGGTTCACCGTCCACGCCACTACAAGGGTGGCAAGTCG
GCGCCCTTATTCGGCAACTTCCTCGAGCCGCTCACCAAGACCCCGTGGTGGTTGATTCCGACTATCTGGCTGCCA
TGTGTCGCATACGGCACCTATCTAGCCTCACAAGGCTACTACGGACCCGCGGCCACGGCCTCTTTCTGGGCGTTT
GGCCTCTTTCTTTGGACGCTTGTAGAGTACGGCATGCATCGGTTTCTGTTCCACGTGGATGAGTACGTTCAGGCC
CGACCAACTCTTCGGGGCGTTTCTTTGGCTAATATTGAATACAGCTACCTGCCCGATAACAGGGTTGGCATCACG
GCGCACTTTCTGCTGCACGGCGTCCATCACTACCTCCCGATGGACAAATATCGCCTGGTGATGCCGCCCGTCCTC
TTTGTCGTCCTGGCGACTCCATTCTGGCGTCTCGCCCATTTTCTTCTGTCCTTCGATTGGCACGCAGCTACGGCC
GTCTTCTGCGGCGGCATCTTCGGCTACATCTGTTACGACCTGACACACTACTTTCTGCACCATCAAAACCTTCCT
CTGTGGTACAAGCAACTCAAGAAGTACCACTTGCAGCATCACTTCCTGGATTACGAACTGGGATTCGGGGTCACG
AGCAAGTTCTGGGACACCGTCTTCGGCACAGAGCTGCAGCCCATCAAGATGAAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail