Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2059
Gene name
LocationContig_1968:437..852
Strand+
Gene length (bp)415
Transcript length (bp)336
Coding sequence length (bp)336
Protein length (aa) 112

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08240 ADH_N Alcohol dehydrogenase GroES-like domain 2.0E-15 34 95

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q04894|ADH6_YEAST NADP-dependent alcohol dehydrogenase 6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADH6 PE=1 SV=1 1 102 2.0E-28
sp|P25377|ADH7_YEAST NADP-dependent alcohol dehydrogenase 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADH7 PE=1 SV=1 1 95 6.0E-26
sp|Q9SJ25|CADH2_ARATH Cinnamyl alcohol dehydrogenase 2 OS=Arabidopsis thaliana GN=CAD2 PE=1 SV=1 32 96 9.0E-14
sp|P42734|CADH9_ARATH Probable cinnamyl alcohol dehydrogenase 9 OS=Arabidopsis thaliana GN=CAD9 PE=2 SV=2 32 93 9.0E-14
sp|Q9SJ10|CADH3_ARATH Cinnamyl alcohol dehydrogenase 3 OS=Arabidopsis thaliana GN=CAD3 PE=1 SV=1 32 96 1.0E-13
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q04894|ADH6_YEAST NADP-dependent alcohol dehydrogenase 6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADH6 PE=1 SV=1 1 102 2.0E-28
sp|P25377|ADH7_YEAST NADP-dependent alcohol dehydrogenase 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADH7 PE=1 SV=1 1 95 6.0E-26
sp|Q9SJ25|CADH2_ARATH Cinnamyl alcohol dehydrogenase 2 OS=Arabidopsis thaliana GN=CAD2 PE=1 SV=1 32 96 9.0E-14
sp|P42734|CADH9_ARATH Probable cinnamyl alcohol dehydrogenase 9 OS=Arabidopsis thaliana GN=CAD9 PE=2 SV=2 32 93 9.0E-14
sp|Q9SJ10|CADH3_ARATH Cinnamyl alcohol dehydrogenase 3 OS=Arabidopsis thaliana GN=CAD3 PE=1 SV=1 32 96 1.0E-13
sp|Q6V4H0|10HGO_CATRO 8-hydroxygeraniol dehydrogenase OS=Catharanthus roseus GN=10HGO PE=1 SV=1 32 96 1.0E-12
sp|P9WQC5|ADHC_MYCTU NADP-dependent alcohol dehydrogenase C OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=adhC PE=1 SV=1 32 96 1.0E-12
sp|P9WQC4|ADHC_MYCTO NADP-dependent alcohol dehydrogenase C OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=adhC PE=3 SV=1 32 96 1.0E-12
sp|P0A4X1|ADHC_MYCBO NADP-dependent alcohol dehydrogenase C OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=adhC PE=3 SV=1 32 96 1.0E-12
sp|Q43137|MTDH1_STYHU Probable mannitol dehydrogenase 1 OS=Stylosanthes humilis GN=CAD1 PE=2 SV=1 35 96 4.0E-12
sp|Q9ZRF1|MTDH_FRAAN Probable mannitol dehydrogenase OS=Fragaria ananassa GN=CAD PE=2 SV=1 32 93 4.0E-12
sp|P0CH37|ADHC2_MYCS2 NADP-dependent alcohol dehydrogenase C 2 OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=adhC2 PE=1 SV=1 23 96 9.0E-12
sp|P0CH36|ADHC1_MYCS2 NADP-dependent alcohol dehydrogenase C 1 OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=adhc1 PE=1 SV=1 23 96 9.0E-12
sp|Q2KNL6|GEDH1_OCIBA Geraniol dehydrogenase 1 OS=Ocimum basilicum GN=GEDH1 PE=1 SV=1 32 96 1.0E-11
sp|P42754|MTDH_PETCR Mannitol dehydrogenase (Fragment) OS=Petroselinum crispum GN=ELI3 PE=2 SV=1 32 96 1.0E-11
sp|O82515|MTDH_MEDSA Probable mannitol dehydrogenase OS=Medicago sativa GN=CAD1 PE=1 SV=1 17 96 2.0E-11
sp|P93257|MTDH_MESCR Probable mannitol dehydrogenase OS=Mesembryanthemum crystallinum GN=ELI3 PE=2 SV=1 32 96 2.0E-11
sp|P27250|AHR_ECOLI Aldehyde reductase Ahr OS=Escherichia coli (strain K12) GN=ahr PE=1 SV=2 20 93 3.0E-11
sp|Q38707|MTDH_APIGR Mannitol dehydrogenase OS=Apium graveolens GN=MTD PE=1 SV=1 32 96 1.0E-10
sp|Q02972|CADH8_ARATH Cinnamyl alcohol dehydrogenase 8 OS=Arabidopsis thaliana GN=CAD8 PE=1 SV=1 32 96 2.0E-10
sp|Q0J6T3|CADH5_ORYSJ Putative cinnamyl alcohol dehydrogenase 5 OS=Oryza sativa subsp. japonica GN=CAD5 PE=3 SV=2 32 96 2.0E-10
sp|P75691|YAHK_ECOLI Aldehyde reductase YahK OS=Escherichia coli (strain K12) GN=yahK PE=1 SV=1 32 93 2.0E-10
sp|P42327|ADH2_GEOSE Alcohol dehydrogenase OS=Geobacillus stearothermophilus GN=adh PE=1 SV=1 19 92 2.0E-10
sp|Q337Y2|CADH3_ORYSJ Probable cinnamyl alcohol dehydrogenase 3 OS=Oryza sativa subsp. japonica GN=CAD3 PE=2 SV=1 32 96 4.0E-10
sp|P31655|CADH2_EUCGU Probable cinnamyl alcohol dehydrogenase 2 OS=Eucalyptus gunnii GN=CAD2 PE=2 SV=1 6 99 6.0E-10
sp|Q42726|CADH1_EUCGU Probable cinnamyl alcohol dehydrogenase 1 OS=Eucalyptus gunnii GN=CAD1 PE=3 SV=1 6 99 8.0E-10
sp|P50746|CADH_EUCBO Probable cinnamyl alcohol dehydrogenase OS=Eucalyptus botryoides GN=CAD1 PE=3 SV=1 6 99 8.0E-10
sp|O64969|CADH_EUCGL Probable cinnamyl alcohol dehydrogenase OS=Eucalyptus globulus GN=CAD PE=2 SV=1 6 99 8.0E-10
sp|Q7XWU3|CADH6_ORYSJ Probable cinnamyl alcohol dehydrogenase 6 OS=Oryza sativa subsp. japonica GN=CAD6 PE=2 SV=2 26 93 8.0E-10
sp|Q10PS6|CADH9_ORYSJ Probable cinnamyl alcohol dehydrogenase 9 OS=Oryza sativa subsp. japonica GN=CAD9 PE=2 SV=1 32 93 1.0E-09
sp|Q0JA75|CADH7_ORYSJ Cinnamyl alcohol dehydrogenase 7 OS=Oryza sativa subsp. japonica GN=CAD7 PE=2 SV=1 26 96 2.0E-09
sp|P31656|CADH_MEDSA Probable cinnamyl alcohol dehydrogenase OS=Medicago sativa GN=CAD2 PE=1 SV=1 32 96 2.0E-09
sp|C0SPA5|ADHA_BACSU Probable formaldehyde dehydrogenase AdhA OS=Bacillus subtilis (strain 168) GN=adhA PE=2 SV=1 20 93 3.0E-09
sp|Q43138|MTDH3_STYHU Probable mannitol dehydrogenase 3 OS=Stylosanthes humilis GN=CAD3 PE=2 SV=1 31 93 7.0E-09
sp|Q02971|CADH7_ARATH Cinnamyl alcohol dehydrogenase 7 OS=Arabidopsis thaliana GN=CAD7 PE=1 SV=2 32 93 1.0E-08
sp|O65621|CADH6_ARATH Probable cinnamyl alcohol dehydrogenase 6 OS=Arabidopsis thaliana GN=CAD6 PE=2 SV=1 32 96 1.0E-08
sp|P07846|DHSO_SHEEP Sorbitol dehydrogenase OS=Ovis aries GN=SORD PE=1 SV=1 28 92 2.0E-08
sp|Q06004|DHSO_BACSU Sorbitol dehydrogenase OS=Bacillus subtilis (strain 168) GN=gutB PE=1 SV=3 23 92 4.0E-08
sp|Q07786|DHSO2_YEAST Sorbitol dehydrogenase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SOR2 PE=3 SV=1 25 92 4.0E-08
sp|P35497|DHSO1_YEAST Sorbitol dehydrogenase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SOR1 PE=3 SV=1 25 92 4.0E-08
sp|Q98D10|XYLD_RHILO Putative D-xylulose reductase OS=Rhizobium loti (strain MAFF303099) GN=mlr4915 PE=3 SV=1 28 90 5.0E-08
sp|Q92MT4|XYLD_RHIME Putative D-xylulose reductase OS=Rhizobium meliloti (strain 1021) GN=R02526 PE=3 SV=1 35 90 8.0E-08
sp|Q9L233|TDH_STRCO L-threonine 3-dehydrogenase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=tdh PE=3 SV=1 28 97 1.0E-07
sp|Q8KQL2|ARPD_ENTAV D-arabitol-phosphate dehydrogenase OS=Enterococcus avium PE=1 SV=1 38 90 1.0E-07
sp|P41637|CADH_PINTA Probable cinnamyl alcohol dehydrogenase OS=Pinus taeda PE=2 SV=1 14 96 1.0E-07
sp|Q40976|CADH_PINRA Probable cinnamyl alcohol dehydrogenase OS=Pinus radiata GN=CAD PE=2 SV=1 14 96 2.0E-07
sp|Q4WAU7|XYL2_ASPFU Probable D-xylulose reductase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=xdhA PE=3 SV=2 21 92 2.0E-07
sp|B0YC65|XYL2_ASPFC Probable D-xylulose reductase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=xdhA PE=3 SV=2 21 92 2.0E-07
sp|P39400|LGOD_ECOLI L-galactonate-5-dehydrogenase OS=Escherichia coli (strain K12) GN=lgoD PE=1 SV=3 28 92 2.0E-07
sp|Q82MN2|TDH_STRAW L-threonine 3-dehydrogenase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=tdh PE=3 SV=1 28 97 3.0E-07
sp|Q9Z9U1|DHSO_BACHD Sorbitol dehydrogenase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=gutB PE=3 SV=1 27 90 3.0E-07
sp|A1CFY8|XYL2_ASPCL Probable D-xylulose reductase A OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=xdhA PE=3 SV=2 21 92 3.0E-07
sp|Q4R0J7|ARD1_UROFA D-arabinitol dehydrogenase 1 OS=Uromyces fabae GN=ARD1 PE=1 SV=1 30 90 4.0E-07
sp|Q1PSI9|IDND_VITVI L-idonate 5-dehydrogenase OS=Vitis vinifera GN=VIT_16s0100g00290 PE=1 SV=2 26 92 5.0E-07
sp|Q96XE0|ADH_SULTO NAD-dependent alcohol dehydrogenase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=adh PE=1 SV=1 28 92 5.0E-07
sp|Q67N85|TDH_SYMTH L-threonine 3-dehydrogenase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=tdh PE=3 SV=1 28 110 6.0E-07
sp|Q57517|Y053_HAEIN Uncharacterized zinc-type alcohol dehydrogenase-like protein HI_0053 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_0053 PE=3 SV=1 26 97 6.0E-07
sp|B1VWE7|TDH_STRGG L-threonine 3-dehydrogenase OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=tdh PE=3 SV=1 28 97 7.0E-07
sp|O31186|ADHA_RHIME Alcohol dehydrogenase OS=Rhizobium meliloti (strain 1021) GN=adhA PE=3 SV=1 28 92 8.0E-07
sp|Q07993|XYL2_YEAST D-xylulose reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=XYL2 PE=1 SV=1 28 92 8.0E-07
sp|Q08350|CADH7_PICAB Probable cinnamyl alcohol dehydrogenase 7/8 OS=Picea abies GN=CAD7 PE=2 SV=1 14 96 8.0E-07
sp|O82035|CADH2_PICAB Probable cinnamyl alcohol dehydrogenase 2 OS=Picea abies GN=CAD2 PE=3 SV=1 14 96 8.0E-07
sp|Q5UQG2|YL498_MIMIV Probable zinc-type alcohol dehydrogenase-like protein L498 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L498 PE=1 SV=1 27 98 8.0E-07
sp|Q58D31|DHSO_BOVIN Sorbitol dehydrogenase OS=Bos taurus GN=SORD PE=2 SV=3 28 92 8.0E-07
sp|A1D9C9|XYL2_NEOFI Probable D-xylulose reductase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=xdhA PE=3 SV=1 21 92 9.0E-07
sp|C5FTT1|XYL2_ARTOC Probable D-xylulose reductase A OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=xdhA PE=3 SV=1 23 99 1.0E-06
sp|Q3IHW0|TDH_PSEHT L-threonine 3-dehydrogenase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=tdh PE=3 SV=1 28 90 1.0E-06
sp|A1S1Q3|TDH_SHEAM L-threonine 3-dehydrogenase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=tdh PE=3 SV=1 28 90 2.0E-06
sp|A6WUG6|TDH_SHEB8 L-threonine 3-dehydrogenase OS=Shewanella baltica (strain OS185) GN=tdh PE=3 SV=1 28 90 2.0E-06
sp|Q0HPI5|TDH_SHESR L-threonine 3-dehydrogenase OS=Shewanella sp. (strain MR-7) GN=tdh PE=3 SV=1 28 90 2.0E-06
sp|Q0HDA3|TDH_SHESM L-threonine 3-dehydrogenase OS=Shewanella sp. (strain MR-4) GN=tdh PE=3 SV=1 28 90 2.0E-06
sp|A0L2Q3|TDH_SHESA L-threonine 3-dehydrogenase OS=Shewanella sp. (strain ANA-3) GN=tdh PE=3 SV=1 28 90 2.0E-06
sp|A9KWY0|TDH_SHEB9 L-threonine 3-dehydrogenase OS=Shewanella baltica (strain OS195) GN=tdh PE=3 SV=1 28 90 2.0E-06
sp|A3CYN0|TDH_SHEB5 L-threonine 3-dehydrogenase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=tdh PE=3 SV=1 28 90 2.0E-06
sp|B8EDS6|TDH_SHEB2 L-threonine 3-dehydrogenase OS=Shewanella baltica (strain OS223) GN=tdh PE=3 SV=1 28 90 2.0E-06
sp|A4YCC5|TDH_SHEPC L-threonine 3-dehydrogenase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=tdh PE=3 SV=1 28 90 2.0E-06
sp|P12311|ADH1_GEOSE Alcohol dehydrogenase OS=Geobacillus stearothermophilus GN=adhT PE=1 SV=2 27 92 2.0E-06
sp|P42328|ADH3_GEOSE Alcohol dehydrogenase OS=Geobacillus stearothermophilus PE=1 SV=1 35 92 2.0E-06
sp|P39462|ADH_SULSO NAD-dependent alcohol dehydrogenase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=adh PE=1 SV=1 28 92 2.0E-06
sp|Q9CAI3|CADH1_ARATH Probable cinnamyl alcohol dehydrogenase 1 OS=Arabidopsis thaliana GN=CAD1 PE=2 SV=1 35 96 2.0E-06
sp|A3QJC8|TDH_SHELP L-threonine 3-dehydrogenase OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=tdh PE=3 SV=1 28 90 2.0E-06
sp|Q2R114|CADH4_ORYSJ Putative cinnamyl alcohol dehydrogenase 4 OS=Oryza sativa subsp. japonica GN=CAD4 PE=3 SV=2 20 96 2.0E-06
sp|P27867|DHSO_RAT Sorbitol dehydrogenase OS=Rattus norvegicus GN=Sord PE=1 SV=4 23 92 2.0E-06
sp|Q64442|DHSO_MOUSE Sorbitol dehydrogenase OS=Mus musculus GN=Sord PE=1 SV=3 23 92 2.0E-06
sp|Q9FJ95|DHSO_ARATH Sorbitol dehydrogenase OS=Arabidopsis thaliana GN=SDH PE=1 SV=1 26 92 2.0E-06
sp|Q8H859|CADH1_ORYSJ Probable cinnamyl alcohol dehydrogenase 1 OS=Oryza sativa subsp. japonica GN=CAD1 PE=2 SV=1 35 96 3.0E-06
sp|C5BB99|TDH_EDWI9 L-threonine 3-dehydrogenase OS=Edwardsiella ictaluri (strain 93-146) GN=tdh PE=3 SV=1 28 90 3.0E-06
sp|Q5HRD6|ADH_STAEQ Alcohol dehydrogenase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=adh PE=3 SV=1 25 93 3.0E-06
sp|Q8CQ56|ADH_STAES Alcohol dehydrogenase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=adh PE=3 SV=1 38 93 3.0E-06
sp|P22797|ADH1_PELPE Alcohol dehydrogenase 1 OS=Pelophylax perezi PE=1 SV=1 25 90 3.0E-06
sp|Q7MY48|TDH_PHOLL L-threonine 3-dehydrogenase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=tdh PE=3 SV=1 28 90 4.0E-06
sp|B1KL24|TDH_SHEWM L-threonine 3-dehydrogenase OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=tdh PE=3 SV=1 28 90 4.0E-06
sp|Q5ARL6|XYL2_EMENI Probable D-xylulose reductase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=xdhA PE=3 SV=1 28 92 4.0E-06
sp|P14941|ADH_THEBR NADP-dependent isopropanol dehydrogenase OS=Thermoanaerobacter brockii GN=adh PE=1 SV=1 9 94 4.0E-06
sp|Q59545|XYLD_MORMO D-xylulose reductase OS=Morganella morganii PE=1 SV=1 31 90 4.0E-06
sp|Q00796|DHSO_HUMAN Sorbitol dehydrogenase OS=Homo sapiens GN=SORD PE=1 SV=4 28 92 4.0E-06
sp|Q0CWQ2|XYL2_ASPTN Probable D-xylulose reductase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=xdhA PE=3 SV=1 21 92 5.0E-06
sp|Q8U7Y1|XYLD_AGRFC Putative D-xylulose reductase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=Atu4318 PE=3 SV=1 31 90 5.0E-06
sp|Q6ERX1|CAD8A_ORYSJ Probable cinnamyl alcohol dehydrogenase 8A OS=Oryza sativa subsp. japonica GN=CAD8A PE=2 SV=1 33 93 5.0E-06
sp|P59410|TDH_VIBPA L-threonine 3-dehydrogenase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=tdh PE=3 SV=1 24 90 5.0E-06
sp|Q8E8J1|TDH_SHEON L-threonine 3-dehydrogenase OS=Shewanella oneidensis (strain MR-1) GN=tdh PE=3 SV=1 28 90 5.0E-06
sp|B6ESA4|TDH_ALISL L-threonine 3-dehydrogenase OS=Aliivibrio salmonicida (strain LFI1238) GN=tdh PE=3 SV=1 24 90 5.0E-06
sp|Q5R5F3|DHSO_PONAB Sorbitol dehydrogenase OS=Pongo abelii GN=SORD PE=2 SV=1 28 92 6.0E-06
sp|A1RE07|TDH_SHESW L-threonine 3-dehydrogenase OS=Shewanella sp. (strain W3-18-1) GN=tdh PE=3 SV=1 28 90 6.0E-06
sp|B5XTI4|TDH_KLEP3 L-threonine 3-dehydrogenase OS=Klebsiella pneumoniae (strain 342) GN=tdh PE=3 SV=1 28 90 6.0E-06
sp|A6TFL2|TDH_KLEP7 L-threonine 3-dehydrogenase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=tdh PE=3 SV=1 28 90 6.0E-06
sp|A1JHX8|TDH_YERE8 L-threonine 3-dehydrogenase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=tdh PE=3 SV=1 28 90 6.0E-06
sp|P25406|ADH1B_SAAHA Alcohol dehydrogenase 1B OS=Saara hardwickii PE=1 SV=2 16 90 6.0E-06
sp|Q29318|DHSO_PIG Sorbitol dehydrogenase (Fragment) OS=Sus scrofa GN=SORD PE=2 SV=2 28 89 7.0E-06
sp|A8GLC6|TDH_SERP5 L-threonine 3-dehydrogenase OS=Serratia proteamaculans (strain 568) GN=tdh PE=3 SV=1 28 90 7.0E-06
sp|B1JQW2|TDH_YERPY L-threonine 3-dehydrogenase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=tdh PE=3 SV=1 28 90 7.0E-06
sp|Q66GC5|TDH_YERPS L-threonine 3-dehydrogenase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=tdh PE=3 SV=1 28 90 7.0E-06
sp|A4TSC6|TDH_YERPP L-threonine 3-dehydrogenase OS=Yersinia pestis (strain Pestoides F) GN=tdh PE=3 SV=1 28 90 7.0E-06
sp|Q1CD13|TDH_YERPN L-threonine 3-dehydrogenase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=tdh PE=3 SV=1 28 90 7.0E-06
sp|A9R685|TDH_YERPG L-threonine 3-dehydrogenase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=tdh PE=3 SV=1 28 90 7.0E-06
sp|Q8ZJN2|TDH_YERPE L-threonine 3-dehydrogenase OS=Yersinia pestis GN=tdh PE=3 SV=1 28 90 7.0E-06
sp|B2JYP4|TDH_YERPB L-threonine 3-dehydrogenase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=tdh PE=3 SV=1 28 90 7.0E-06
sp|Q1C278|TDH_YERPA L-threonine 3-dehydrogenase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=tdh PE=3 SV=1 28 90 7.0E-06
sp|A7FCU5|TDH_YERP3 L-threonine 3-dehydrogenase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=tdh PE=3 SV=1 28 90 7.0E-06
sp|Q5GN51|XYL2_ASPNG D-xylulose reductase A OS=Aspergillus niger GN=xdhA PE=3 SV=1 21 92 7.0E-06
sp|A2QY54|XYL2_ASPNC Probable D-xylulose reductase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=xdhA PE=3 SV=1 21 92 7.0E-06
sp|P47734|FADH_METMR S-(hydroxymethyl)glutathione dehydrogenase OS=Methylobacter marinus GN=fdh PE=3 SV=2 35 92 8.0E-06
sp|Q02BT1|TDH_SOLUE L-threonine 3-dehydrogenase OS=Solibacter usitatus (strain Ellin6076) GN=tdh PE=3 SV=1 13 99 8.0E-06
sp|Q4R639|DHSO_MACFA Sorbitol dehydrogenase OS=Macaca fascicularis GN=SORD PE=2 SV=3 28 92 8.0E-06
sp|P49645|ADH1_APTAU Alcohol dehydrogenase 1 OS=Apteryx australis GN=ADH1 PE=1 SV=2 16 90 9.0E-06
sp|B7LVH6|TDH_ESCF3 L-threonine 3-dehydrogenase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=tdh PE=3 SV=1 28 90 9.0E-06
sp|Q07W50|TDH_SHEFN L-threonine 3-dehydrogenase OS=Shewanella frigidimarina (strain NCIMB 400) GN=tdh PE=3 SV=1 28 90 1.0E-05
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup149
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2070
Ophiocordyceps australis map64 (Brazil) OphauB2|1781
Ophiocordyceps australis map64 (Brazil) OphauB2|2415
Ophiocordyceps camponoti-floridani Ophcf2|01585
Ophiocordyceps camponoti-rufipedis Ophun1|2059 (this protein)
Ophiocordyceps kimflemingae Ophio5|1253
Ophiocordyceps kimflemingae Ophio5|3276
Ophiocordyceps subramaniannii Hirsu2|10293
Ophiocordyceps subramaniannii Hirsu2|10526
Ophiocordyceps subramaniannii Hirsu2|2151

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2059
MGYPDTFTGFCVSSPETWNQFHKAELKPKPFGEHDIDVEIEACGVCGSDVHSITGGWGKFEGPLCVGHEIVGRAV
RVGSHVRDIKKGDRVGVGAQVCIRMGRGLMGASRLM*
Coding >Ophun1|2059
ATGGGCTACCCCGACACCTTTACCGGCTTCTGCGTCTCCAGCCCGGAGACTTGGAACCAGTTCCACAAGGCGGAG
CTGAAGCCCAAGCCCTTTGGCGAGCACGACATCGACGTCGAGATCGAGGCGTGCGGCGTGTGCGGCTCCGACGTG
CACAGCATCACGGGCGGCTGGGGCAAGTTCGAGGGCCCCCTTTGCGTGGGCCACGAGATTGTCGGACGGGCGGTG
CGGGTGGGATCGCACGTGCGGGATATAAAGAAGGGGGATCGGGTGGGCGTCGGGGCGCAGGTTTGTATCCGGATG
GGTCGTGGGCTCATGGGGGCTTCGCGTCTCATGTGA
Transcript >Ophun1|2059
ATGGGCTACCCCGACACCTTTACCGGCTTCTGCGTCTCCAGCCCGGAGACTTGGAACCAGTTCCACAAGGCGGAG
CTGAAGCCCAAGCCCTTTGGCGAGCACGACATCGACGTCGAGATCGAGGCGTGCGGCGTGTGCGGCTCCGACGTG
CACAGCATCACGGGCGGCTGGGGCAAGTTCGAGGGCCCCCTTTGCGTGGGCCACGAGATTGTCGGACGGGCGGTG
CGGGTGGGATCGCACGTGCGGGATATAAAGAAGGGGGATCGGGTGGGCGTCGGGGCGCAGGTTTGTATCCGGATG
GGTCGTGGGCTCATGGGGGCTTCGCGTCTCATGTGA
Gene >Ophun1|2059
ATGGGCTACCCCGACACCTTTACCGGCTTCTGCGTCTCCAGCCCGGAGACTTGGAACCAGTTCCACAAGGCGGAG
CTGAAGCCCAAGCCCTTTGGCGAGCACGACATCGACGTCGAGATCGAGGCGTGCGGCGTGTGCGGCTCCGACGTG
CACAGCATCACGGGCGGCTGGGGCAAGTTCGAGGGCCCCCTTTGCGTGGGCCACGAGATTGTCGGACGGGCGGTG
CGGGTGGGATCGCACGTGCGGGATATAAAGAAGGGGGATCGGGTGGGCGTCGGGGCGCAGGTTTGGTCGTGTCTC
GAGTGTGGGCTCTGTCGTGACGGGAATGAGAATTACTGTCCGAAGCTGGTTGATACGTATAACGCGCAGTATCCG
GATGGGTCGTGGGCTCATGGGGGCTTCGCGTCTCATGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail