Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2058
Gene name
LocationContig_1962:5..1067
Strand-
Gene length (bp)1062
Transcript length (bp)822
Coding sequence length (bp)822
Protein length (aa) 274

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14792 DNA_pol_B_palm DNA polymerase beta palm 1.2E-30 126 254
PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda 1.6E-19 76 123
PF14716 HHH_8 Helix-hairpin-helix domain 4.9E-14 1 55

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4R380|DPOLL_MACFA DNA polymerase lambda OS=Macaca fascicularis GN=POLL PE=2 SV=1 1 272 1.0E-47
sp|Q9UGP5|DPOLL_HUMAN DNA polymerase lambda OS=Homo sapiens GN=POLL PE=1 SV=1 1 272 3.0E-46
sp|Q5RKI3|DPOLL_RAT DNA polymerase lambda OS=Rattus norvegicus GN=Poll PE=2 SV=1 1 272 4.0E-45
sp|Q9QXE2|DPOLL_MOUSE DNA polymerase lambda OS=Mus musculus GN=Poll PE=2 SV=1 1 272 4.0E-45
sp|P06766|DPOLB_RAT DNA polymerase beta OS=Rattus norvegicus GN=Polb PE=1 SV=4 13 272 8.0E-42
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4R380|DPOLL_MACFA DNA polymerase lambda OS=Macaca fascicularis GN=POLL PE=2 SV=1 1 272 1.0E-47
sp|Q9UGP5|DPOLL_HUMAN DNA polymerase lambda OS=Homo sapiens GN=POLL PE=1 SV=1 1 272 3.0E-46
sp|Q5RKI3|DPOLL_RAT DNA polymerase lambda OS=Rattus norvegicus GN=Poll PE=2 SV=1 1 272 4.0E-45
sp|Q9QXE2|DPOLL_MOUSE DNA polymerase lambda OS=Mus musculus GN=Poll PE=2 SV=1 1 272 4.0E-45
sp|P06766|DPOLB_RAT DNA polymerase beta OS=Rattus norvegicus GN=Polb PE=1 SV=4 13 272 8.0E-42
sp|Q8K409|DPOLB_MOUSE DNA polymerase beta OS=Mus musculus GN=Polb PE=1 SV=3 13 272 2.0E-41
sp|O57383|DPOLB_XENLA DNA polymerase beta OS=Xenopus laevis GN=polb PE=1 SV=3 13 272 5.0E-41
sp|Q27958|DPOLB_BOVIN DNA polymerase beta OS=Bos taurus GN=POLB PE=2 SV=3 1 272 6.0E-41
sp|P06746|DPOLB_HUMAN DNA polymerase beta OS=Homo sapiens GN=POLB PE=1 SV=3 13 272 1.0E-40
sp|Q6DRD3|DPOLB_DANRE DNA polymerase beta OS=Danio rerio GN=polb PE=2 SV=2 1 272 9.0E-38
sp|Q7T6Y4|DPOLX_MIMIV Probable DNA polymerase family X OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L318 PE=1 SV=2 3 266 3.0E-28
sp|Q9JIW4|DPOLM_MOUSE DNA-directed DNA/RNA polymerase mu OS=Mus musculus GN=Polm PE=1 SV=2 16 272 3.0E-24
sp|Q9NP87|DPOLM_HUMAN DNA-directed DNA/RNA polymerase mu OS=Homo sapiens GN=POLM PE=1 SV=1 17 272 4.0E-24
sp|Q09693|DPO4_SCHPO DNA polymerase type-X family protein pol4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pol4 PE=3 SV=1 13 272 1.0E-23
sp|Q92089|TDT_ONCMY DNA nucleotidylexotransferase OS=Oncorhynchus mykiss GN=dntt PE=2 SV=1 16 201 2.0E-18
sp|P42118|TDT_XENLA DNA nucleotidylexotransferase OS=Xenopus laevis GN=dntt PE=2 SV=1 1 272 3.0E-18
sp|O02789|TDT_MONDO DNA nucleotidylexotransferase OS=Monodelphis domestica GN=DNTT PE=2 SV=1 1 272 6.0E-18
sp|O57486|TDT_AMBME DNA nucleotidylexotransferase OS=Ambystoma mexicanum GN=DNTT PE=2 SV=2 1 272 1.0E-17
sp|P04053|TDT_HUMAN DNA nucleotidylexotransferase OS=Homo sapiens GN=DNTT PE=1 SV=3 17 272 1.0E-16
sp|P25615|DPO4_YEAST DNA polymerase IV OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=POL4 PE=1 SV=4 5 212 5.0E-16
sp|A4PCD4|TDT_EULMA DNA nucleotidylexotransferase OS=Eulemur macaco GN=DNTT PE=3 SV=1 1 272 4.0E-15
sp|P06526|TDT_BOVIN DNA nucleotidylexotransferase OS=Bos taurus GN=DNTT PE=1 SV=2 73 272 8.0E-15
sp|P09838|TDT_MOUSE DNA nucleotidylexotransferase OS=Mus musculus GN=Dntt PE=1 SV=3 16 272 3.0E-14
sp|P36195|TDT_CHICK DNA nucleotidylexotransferase OS=Gallus gallus GN=DNTT PE=2 SV=1 1 272 1.0E-12
[Show less]

GO

GO Term Description Terminal node
GO:0003677 DNA binding Yes
GO:0034061 DNA polymerase activity Yes
GO:0097159 organic cyclic compound binding No
GO:0003674 molecular_function No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0016779 nucleotidyltransferase activity No
GO:0016740 transferase activity No
GO:0003824 catalytic activity No
GO:0003676 nucleic acid binding No
GO:1901363 heterocyclic compound binding No
GO:0005488 binding No
GO:0140097 catalytic activity, acting on DNA No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup485
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5970
Ophiocordyceps australis map64 (Brazil) OphauB2|2294
Ophiocordyceps camponoti-floridani Ophcf2|07199
Ophiocordyceps camponoti-rufipedis Ophun1|2058 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|7249
Ophiocordyceps kimflemingae Ophio5|7563
Ophiocordyceps subramaniannii Hirsu2|10849
Ophiocordyceps subramaniannii Hirsu2|6174

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2058
MADYYERVDDHWRSSGYRKAISTLRRQTVKVRTAEEAVKLPQIGWRIAHKIEEIASTDRLRRLEYAQEEPTDEAL
QLFLHIYGVGSKLAQQWVARGYRTLDDVAKGARLTASQRVGLEHYHDLRERIPRREVEAIGEAVRRTARGIDPGV
EFITGGSYRRGADSSGDVDLIVTKKGTCKAVELRPFLDELVDRLEDEGIVVARLSTPHHVRKTTDGKDVSGGLSI
WHGCCVLPRGEAASGAPTWRRLDMLLVPETQMGAALLYFTGDDLFNRI*
Coding >Ophun1|2058
ATGGCAGATTACTACGAGCGCGTCGACGACCACTGGCGATCGTCGGGTTATCGCAAGGCCATCAGCACGCTGAGA
CGTCAGACGGTCAAGGTGCGGACGGCGGAGGAGGCGGTGAAGCTCCCCCAGATCGGATGGCGCATCGCGCACAAG
ATTGAGGAGATTGCTTCGACGGACCGGCTACGAAGACTCGAGTATGCGCAGGAGGAGCCGACGGACGAGGCGCTG
CAGCTCTTCCTGCACATTTACGGCGTCGGCAGCAAGCTGGCTCAGCAGTGGGTGGCGCGCGGGTACCGGACTCTG
GATGACGTGGCCAAGGGGGCGCGGTTGACGGCCAGTCAGCGGGTTGGGCTGGAGCATTACCACGATCTGAGGGAG
AGGATTCCGCGGCGGGAGGTTGAGGCCATCGGGGAGGCGGTGAGGCGGACGGCGAGGGGGATCGATCCGGGGGTT
GAGTTCATTACGGGTGGGAGTTATCGTCGGGGGGCTGATAGCTCGGGTGATGTGGATTTGATTGTCACCAAGAAG
GGGACTTGCAAGGCGGTTGAGCTGCGGCCTTTTCTCGATGAGTTGGTGGATAGGCTGGAGGATGAGGGCATCGTG
GTGGCACGACTATCAACACCGCATCACGTCCGCAAAACCACCGACGGAAAAGACGTCAGCGGCGGCCTGAGCATC
TGGCACGGGTGCTGCGTCCTGCCGCGAGGCGAGGCAGCCAGCGGGGCACCGACATGGCGGCGTCTGGACATGCTG
CTGGTTCCCGAGACGCAGATGGGGGCGGCGCTGCTGTATTTCACGGGCGACGATCTGTTTAATCGGATTTAA
Transcript >Ophun1|2058
ATGGCAGATTACTACGAGCGCGTCGACGACCACTGGCGATCGTCGGGTTATCGCAAGGCCATCAGCACGCTGAGA
CGTCAGACGGTCAAGGTGCGGACGGCGGAGGAGGCGGTGAAGCTCCCCCAGATCGGATGGCGCATCGCGCACAAG
ATTGAGGAGATTGCTTCGACGGACCGGCTACGAAGACTCGAGTATGCGCAGGAGGAGCCGACGGACGAGGCGCTG
CAGCTCTTCCTGCACATTTACGGCGTCGGCAGCAAGCTGGCTCAGCAGTGGGTGGCGCGCGGGTACCGGACTCTG
GATGACGTGGCCAAGGGGGCGCGGTTGACGGCCAGTCAGCGGGTTGGGCTGGAGCATTACCACGATCTGAGGGAG
AGGATTCCGCGGCGGGAGGTTGAGGCCATCGGGGAGGCGGTGAGGCGGACGGCGAGGGGGATCGATCCGGGGGTT
GAGTTCATTACGGGTGGGAGTTATCGTCGGGGGGCTGATAGCTCGGGTGATGTGGATTTGATTGTCACCAAGAAG
GGGACTTGCAAGGCGGTTGAGCTGCGGCCTTTTCTCGATGAGTTGGTGGATAGGCTGGAGGATGAGGGCATCGTG
GTGGCACGACTATCAACACCGCATCACGTCCGCAAAACCACCGACGGAAAAGACGTCAGCGGCGGCCTGAGCATC
TGGCACGGGTGCTGCGTCCTGCCGCGAGGCGAGGCAGCCAGCGGGGCACCGACATGGCGGCGTCTGGACATGCTG
CTGGTTCCCGAGACGCAGATGGGGGCGGCGCTGCTGTATTTCACGGGCGACGATCTGTTTAATCGGATTTAA
Gene >Ophun1|2058
ATGGCAGATTACTACGAGCGCGTCGACGACCACTGGCGATCGTCGGGTTATCGCAAGGCCATCAGCACGCTGAGA
CGTCAGACGGTCAAGGTGCGGACGGCGGAGGAGGCGGTGAAGCTCCCCCAGATCGGATGGCGCATCGCGCACAAG
ATTGAGGAGATTGCTTCGACGGACCGGCTACGAAGACTCGAGTATGCGCAGGAGGAGCCGACGGACGAGGCGCTG
CAGCTCTTCCTGCACATTTACGGCGTCGGCAGCAAGCTGGCTCAGCAGTGGGTGGCGCGCGGGTACCGGACTCTG
GATGACGTGGCCAAGGGGGCGCGGTTGACGGCCAGTCAGCGGGTTGGGCTGGAGCATTACCACGATCTGAGGGAG
AGGATTCCGCGGCGGGAGGTTGAGGCCATCGGGGAGGCGGTGAGGCGGACGGCGAGGGGGATCGATCCGGGGGTT
GAGTTCATTACGGGTGGGAGTTATCGTCGGGGGGCTGATAGCTCGGGTGATGTGGATTTGATTGTCACCAAGAAG
GGGACTTGCAAGGCGGTTGAGCTGCGGCCTTTTCTCGATGAGTTGGTGGATAGGCTGGAGGATGAGGGCATCGTG
GTGGCACGACTATCAACACCGCATCACGTCCGCAAAACCACCGACGGAAAAGACGTCAGCGGCGGCCTGAGCATC
TGGCACGGGTGCTGCGTCCTGCCGCGAGGCGAGGCAGCCAGCGGGGCACCGACATGGCGGCGTCTGGACATGCTG
CTGGTTCCCGAGACGCAGATGGGGGCGGCGCTGCTGTATTTCACGGGCGACGATCTGTTTAATCGGAGTATGAGG
CTGCTTGCGCGAAGGAAGGGGTTGAGGCTGAATCAGAGGGGGTTGTGGCGGGGGGGGGGGGTGGTTGTGGGGGGG
GGGGGGGGGGGGGGGTGTTGGGGTGTGGGGGGGGGGGGGGGGGGGGGGGGGGAGGGGGGGGGTGGGTTTTGGTGG
GGTTGGGGGGGAAGGTGGTTCTTTATACCAACCTACCGTGCTCGACAAAAGGGGAGAGTGAGACTGCGAGGGGCG
AGCGTAGTTTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail