Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2055
Gene name
LocationContig_196:16508..17511
Strand+
Gene length (bp)1003
Transcript length (bp)513
Coding sequence length (bp)513
Protein length (aa) 171

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O13932|BET1_SCHPO Protein transport protein bet1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bet1 PE=3 SV=1 79 167 8.0E-20
sp|P22804|BET1_YEAST Protein transport protein BET1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BET1 PE=1 SV=1 71 170 2.0E-18
sp|Q62896|BET1_RAT BET1 homolog OS=Rattus norvegicus GN=Bet1 PE=1 SV=1 66 169 5.0E-08
sp|O35623|BET1_MOUSE BET1 homolog OS=Mus musculus GN=Bet1 PE=1 SV=1 65 169 3.0E-07

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.45

Transmembrane Domains

Domain # Start End Length
1 147 169 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2055
MPISSLHVPFGASSLHQRDSRSALFAGYTGEPATTTRRPNNAGGYGYPQRQQQQPLGLEKQGFRPATPNGKGQYS
DAVLNELESQNDAHVEGILGKVRTLKDMTMAIGDEIRESSALADKMNDSFDSARLRLRGTMNRMLIMAQRTGVGW
KVWLAFFAAVALLFFYVWVS*
Coding >Ophun1|2055
ATGCCGATCTCATCTCTGCACGTGCCATTCGGCGCATCGTCGTTGCACCAGCGCGACTCGCGAAGCGCCCTCTTC
GCCGGCTACACGGGCGAACCAGCGACGACGACCAGAAGGCCCAACAACGCGGGCGGCTACGGCTACCCCCAGCGA
CAACAGCAGCAGCCGCTCGGCCTAGAAAAACAAGGCTTCCGCCCGGCGACGCCCAATGGAAAGGGCCAGTACAGC
GATGCGGTGCTCAACGAGCTGGAGAGCCAGAACGACGCCCACGTCGAGGGTATACTGGGCAAGGTGCGGACGCTC
AAGGACATGACGATGGCTATTGGCGATGAGATACGCGAGTCATCCGCCCTGGCCGACAAGATGAACGACAGCTTC
GACTCGGCGCGTCTTCGTCTTCGCGGGACTATGAATCGCATGCTCATCATGGCACAACGTACCGGCGTCGGCTGG
AAGGTCTGGCTCGCCTTCTTCGCTGCCGTCGCCCTGCTTTTCTTCTACGTGTGGGTGTCCTGA
Transcript >Ophun1|2055
ATGCCGATCTCATCTCTGCACGTGCCATTCGGCGCATCGTCGTTGCACCAGCGCGACTCGCGAAGCGCCCTCTTC
GCCGGCTACACGGGCGAACCAGCGACGACGACCAGAAGGCCCAACAACGCGGGCGGCTACGGCTACCCCCAGCGA
CAACAGCAGCAGCCGCTCGGCCTAGAAAAACAAGGCTTCCGCCCGGCGACGCCCAATGGAAAGGGCCAGTACAGC
GATGCGGTGCTCAACGAGCTGGAGAGCCAGAACGACGCCCACGTCGAGGGTATACTGGGCAAGGTGCGGACGCTC
AAGGACATGACGATGGCTATTGGCGATGAGATACGCGAGTCATCCGCCCTGGCCGACAAGATGAACGACAGCTTC
GACTCGGCGCGTCTTCGTCTTCGCGGGACTATGAATCGCATGCTCATCATGGCACAACGTACCGGCGTCGGCTGG
AAGGTCTGGCTCGCCTTCTTCGCTGCCGTCGCCCTGCTTTTCTTCTACGTGTGGGTGTCCTGA
Gene >Ophun1|2055
ATGCCGATCTCATCTCTGCACGTGCCGTGAGTCGCAGATGCCTGACATGTCAGGCTGTCAGGTGCAACGATCCCG
TGACAAGAGTGGGTCCGTACCCCGGCGTTGCTGCGGGTTCCGGCCCAAGGTCGTTTAACTCTCGTCAACAAACTT
ACCCTAGATACGAATCCCTACAACTCAAAGGTCAGGGAGATCTCAGCGGCCAAGGGGCTCTCTATCCGCTTCCCT
CCATCTACTTGATCTGGGTGCCCGTCTTCAGAATTTAACCGCCTCGAATACGACCGACAATCCTATCGTCGTTAC
AGCTGTTTACACAGAGGCCGTCCGGGATTCTCCTCGGGGAGCGGACGAGCGATGGCGCAGAGGTGAGGCAACAGC
AAACAGACAGAGCCTTCACAACGAGTTGAAACGCATGAAAAGACAGAAAACTAACTCGACAATGACGGAGCAGAT
TCGGCGCATCGTCGTTGCACCAGCGCGACTCGCGAAGCGCCCTCTTCGCCGGCTACACGGGCGAACCAGCGACGA
CGACCAGAAGGCCCAACAACGCGGGCGGCTACGGCTACCCCCAGCGACAACAGCAGCAGCCGCTCGGCCTAGAAA
AACAAGGCTTCCGCCCGGCGACGCCCAATGGAAAGGGCCAGTACAGCGATGCGGTGCTCAACGAGCTGGAGAGCC
AGAACGACGCCCACGTCGAGGGTATACTGGGCAAGGTGCGGACGCTCAAGGACGTGAGTTGCCGCGCCTCTCGCA
GGCCATCTCTTCCTTGCGCGCGTATGCGATATTGACGGGAGGGCAGATGACGATGGCTATTGGCGATGAGATACG
CGAGTCATCCGCCCTGGCCGACAAGATGAACGACAGCTTCGACTCGGCGCGTCTTCGTCTTCGCGGGACTATGAA
TCGCATGCTCATCATGGCACAACGTACCGGCGTCGGCTGGAAGGTCTGGCTCGCCTTCTTCGCTGCCGTCGCCCT
GCTTTTCTTCTACGTGTGGGTGTCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail