Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2044
Gene name
LocationContig_195:25074..28390
Strand+
Gene length (bp)3316
Transcript length (bp)3132
Coding sequence length (bp)3132
Protein length (aa) 1044

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03810 IBN_N Importin-beta N-terminal domain 2.7E-10 23 97

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q10297|IMB5_SCHPO Importin subunit beta-5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=kap114 PE=3 SV=3 1 1040 5.0E-85
sp|Q91YE6|IPO9_MOUSE Importin-9 OS=Mus musculus GN=Ipo9 PE=1 SV=3 1 1017 4.0E-59
sp|Q96P70|IPO9_HUMAN Importin-9 OS=Homo sapiens GN=IPO9 PE=1 SV=3 1 1041 2.0E-57
sp|P53067|IMB5_YEAST Importin subunit beta-5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KAP114 PE=1 SV=1 366 937 1.0E-31
sp|Q9XZU1|XPO2_DROME Exportin-2 OS=Drosophila melanogaster GN=Cas PE=2 SV=2 5 458 8.0E-12
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q10297|IMB5_SCHPO Importin subunit beta-5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=kap114 PE=3 SV=3 1 1040 5.0E-85
sp|Q91YE6|IPO9_MOUSE Importin-9 OS=Mus musculus GN=Ipo9 PE=1 SV=3 1 1017 4.0E-59
sp|Q96P70|IPO9_HUMAN Importin-9 OS=Homo sapiens GN=IPO9 PE=1 SV=3 1 1041 2.0E-57
sp|P53067|IMB5_YEAST Importin subunit beta-5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KAP114 PE=1 SV=1 366 937 1.0E-31
sp|Q9XZU1|XPO2_DROME Exportin-2 OS=Drosophila melanogaster GN=Cas PE=2 SV=2 5 458 8.0E-12
sp|P53067|IMB5_YEAST Importin subunit beta-5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KAP114 PE=1 SV=1 7 167 7.0E-11
sp|Q7SZC2|XPO2_DANRE Exportin-2 OS=Danio rerio GN=cse1l PE=2 SV=1 5 467 7.0E-09
sp|P33307|CSE1_YEAST Importin alpha re-exporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CSE1 PE=1 SV=2 21 462 3.0E-08
sp|Q8AY73|XPO2_ORENI Exportin-2 OS=Oreochromis niloticus GN=cse1l PE=2 SV=1 5 218 3.0E-07
sp|Q9PTU3|XPO2_PAGMA Exportin-2 OS=Pagrus major GN=cse1l PE=2 SV=1 16 218 2.0E-06
sp|Q9ERK4|XPO2_MOUSE Exportin-2 OS=Mus musculus GN=Cse1l PE=1 SV=1 5 218 8.0E-06
sp|P55060|XPO2_HUMAN Exportin-2 OS=Homo sapiens GN=CSE1L PE=1 SV=3 5 218 8.0E-06
sp|A5D785|XPO2_BOVIN Exportin-2 OS=Bos taurus GN=CSE1L PE=2 SV=1 5 218 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006886 intracellular protein transport Yes
GO:0031267 small GTPase binding Yes
GO:0019899 enzyme binding No
GO:0006810 transport No
GO:0009987 cellular process No
GO:0008104 protein localization No
GO:0046907 intracellular transport No
GO:0051234 establishment of localization No
GO:0051649 establishment of localization in cell No
GO:0071705 nitrogen compound transport No
GO:0033036 macromolecule localization No
GO:0051179 localization No
GO:0071702 organic substance transport No
GO:0070727 cellular macromolecule localization No
GO:0005515 protein binding No
GO:0015031 protein transport No
GO:0003674 molecular_function No
GO:0045184 establishment of protein localization No
GO:0005488 binding No
GO:0008150 biological_process No
GO:0051020 GTPase binding No
GO:0051641 cellular localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 53 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2044
MEDQLVQLLANTQLADQVPRRQAEMELSRAETNPAFPVCLANIASHASVVTAVRQSALTTLRLFIERNWADEDAS
DGTPVPIADEARLLLKQSLLDLALGLDEDRKVKIAASYAVGKIAIHDFPDQWPTLLPTVLGVMPSGTDSQLHGAL
RVLGDLVEESLSEDQFFSMARDIADALTRVALDGSRKPMLRALAVSVFRGCIDLMNMVKDSHAQEVDAFAKQLLE
GDAGSSAAWIPFFISIIREPLPPADLTDGQPEEWNSIVALKLQVVKTLIRLRRAFANLLSPHSTTLFSAVWDELT
NMQEPHDQLYIQANAQGRLEDSDNLPYTLDFLVLEELDFLNQCFRAPRVKAELDSQLNAHASAQDVPWMVQIMTM
LVNYARVTREEEELWDIDCSLYLAEETSVTANYTARTAAGDLLIKMGEWFDQKTIDGLYGCTRGLFPGSDDSSWR
RQESALYLFVMLLSDMQDLGKTVSEPVAVEYYKLVDLAISKADKPLLRARGYLVAGMLGQNFPLPSVQPSPTSAA
ESLLDHMIKAITGKQSEVVQVACVKAVEGLVRAERVSLDKQAPVIAAIQSYMNSKDPGDMEEADELLVTLAEALK
AAIMMNTEVALSTEVQPIDMLFLLAKLGASNFQVTVLVSEAFEEIVKALSSGPSFGALCAKTLPTLTGAFDVANL
TDDNPLVTVATELLAVLAEHGSEPLPEGFVAATLPKLSRLLMESNEGEVLRPGSETVKWILMHDHQQVFGWQDAN
GVSGLEVCLRIIDRLLKPEIEDNSASEVGGLAAELVEKAGQERLGPFLPQLLQAVATRVDSAQAAAFIQSLILVF
ARLSLTGAHDVVEFLSQLQINGQSGLQIVLAKWLENSVSFAGYDEIRQNVIALSKLYSLNDARLSQIMVKGDLMV
GGDDGRIKTRSRAKQNPDQYTVIPATLKIIKVLIEELLSASGAQAAANAASAAIAAHGETEAGDDDDGWEDDDDT
LDLSLGASKSDLLFFSDAGGRRQRDDETQAYLTDFFMRCARENVAGFQDWYGMLTEEEKAKLNRLAGQ*
Coding >Ophun1|2044
ATGGAGGACCAGCTCGTGCAGCTGCTCGCCAACACGCAGCTGGCCGACCAGGTGCCGCGCAGACAGGCCGAGATG
GAGCTCTCACGGGCCGAGACGAACCCGGCGTTTCCCGTCTGCCTGGCCAATATTGCCTCGCACGCGTCTGTCGTC
ACGGCCGTTCGCCAGTCGGCCTTGACGACGCTTCGACTCTTCATCGAGCGGAACTGGGCCGACGAGGACGCTTCC
GACGGTACGCCCGTGCCGATTGCCGACGAGGCTCGGCTATTGCTCAAGCAATCCTTGCTCGACCTTGCTCTTGGT
CTCGATGAGGACCGCAAGGTCAAGATTGCTGCCAGCTACGCTGTTGGAAAAATCGCCATCCACGACTTTCCCGAT
CAATGGCCGACCCTCCTCCCGACGGTCCTCGGCGTCATGCCCTCGGGCACCGACTCTCAGCTGCACGGCGCGCTG
CGTGTGCTGGGAGACCTCGTCGAGGAGAGCCTGAGCGAGGACCAGTTCTTCTCCATGGCCCGCGACATTGCCGAT
GCCCTGACGCGCGTGGCCCTCGACGGCTCCCGCAAGCCCATGCTCCGAGCACTCGCCGTCTCCGTCTTTCGCGGA
TGCATTGACCTCATGAACATGGTCAAAGATAGCCACGCGCAAGAGGTTGATGCGTTCGCAAAGCAGCTGCTCGAG
GGCGACGCCGGCTCCTCGGCCGCCTGGATCCCCTTCTTCATCTCGATTATCCGGGAGCCGTTGCCCCCAGCCGAC
CTAACGGATGGCCAGCCCGAGGAGTGGAATAGCATCGTCGCGCTCAAGCTGCAAGTCGTCAAGACGCTGATCCGA
CTGAGGCGCGCCTTTGCCAACCTCCTATCTCCCCACAGCACCACGCTCTTCAGCGCTGTTTGGGACGAGCTCACC
AATATGCAGGAGCCCCACGATCAGCTCTACATCCAGGCTAATGCCCAGGGGAGACTCGAGGACTCGGACAACCTG
CCCTACACGCTCGACTTTCTCGTCCTCGAGGAGCTCGACTTCCTGAACCAGTGCTTCCGCGCGCCCCGTGTCAAG
GCCGAGCTCGACTCGCAGCTGAATGCACACGCATCCGCCCAGGACGTGCCGTGGATGGTCCAGATCATGACGATG
CTCGTCAACTACGCCCGTGTCACGCGCGAGGAGGAGGAGCTGTGGGACATTGACTGCTCGCTCTACCTGGCCGAG
GAGACGTCGGTGACGGCAAATTACACGGCGCGGACGGCGGCCGGCGATCTGCTCATCAAAATGGGCGAGTGGTTC
GATCAAAAGACCATCGACGGCCTCTACGGTTGCACGAGAGGCCTCTTCCCCGGCAGCGACGACTCATCGTGGCGC
CGCCAAGAGTCCGCCCTGTACCTGTTCGTCATGCTGCTCAGCGACATGCAGGACCTGGGCAAGACCGTCTCGGAG
CCCGTCGCCGTCGAGTACTACAAGCTGGTGGACCTGGCCATCTCAAAGGCCGACAAGCCGCTGCTGCGCGCCCGG
GGCTATCTGGTGGCCGGCATGCTCGGCCAGAACTTTCCGCTGCCGTCGGTGCAGCCGAGCCCGACGAGCGCGGCC
GAGTCCCTGCTGGACCACATGATCAAGGCCATCACGGGCAAGCAGTCGGAGGTGGTGCAGGTCGCCTGCGTCAAG
GCCGTCGAGGGCCTCGTCAGGGCCGAGAGGGTGAGCCTCGACAAGCAGGCGCCCGTCATCGCCGCCATACAGTCG
TACATGAACAGCAAGGACCCGGGCGACATGGAGGAGGCGGACGAGCTGCTGGTGACGCTGGCCGAGGCGCTCAAG
GCGGCCATCATGATGAACACCGAGGTTGCGCTCTCGACAGAGGTCCAGCCCATCGACATGCTCTTCCTGCTGGCC
AAGCTGGGAGCCAGCAACTTTCAGGTGACGGTGCTGGTCTCGGAAGCCTTTGAGGAGATTGTCAAGGCGCTGTCG
AGCGGGCCCTCGTTCGGCGCCCTCTGCGCCAAGACGCTGCCGACGCTGACGGGCGCCTTTGACGTGGCGAACCTG
ACGGACGACAACCCGCTGGTGACGGTGGCGACGGAGCTGCTGGCCGTCCTGGCCGAGCACGGGTCCGAACCCCTG
CCCGAGGGCTTCGTGGCGGCGACTCTTCCCAAGCTCAGCCGGCTGTTGATGGAGTCGAACGAGGGCGAAGTGCTG
CGTCCGGGCTCGGAGACGGTCAAATGGATCCTGATGCACGACCACCAGCAGGTGTTTGGCTGGCAAGACGCCAAC
GGGGTCTCGGGGCTGGAGGTGTGCCTGCGCATCATCGACCGGCTGCTGAAGCCCGAGATCGAGGACAACTCGGCC
TCCGAGGTGGGCGGACTGGCGGCCGAGCTGGTGGAAAAGGCGGGCCAGGAGCGGCTCGGACCGTTTCTGCCCCAG
CTGTTGCAGGCGGTGGCGACGCGCGTGGATTCGGCTCAGGCGGCGGCCTTCATCCAGTCGCTGATCCTGGTGTTT
GCGCGGCTCTCGTTGACGGGCGCCCACGACGTGGTCGAGTTCCTCAGCCAGCTGCAGATCAACGGTCAGAGCGGA
CTCCAGATTGTGCTGGCCAAGTGGCTGGAGAACTCGGTCAGCTTTGCGGGATACGACGAGATTCGACAAAATGTC
ATTGCGCTTTCGAAACTGTACTCGCTCAACGACGCCCGGCTGTCGCAGATCATGGTCAAGGGCGACTTGATGGTG
GGCGGCGACGATGGGAGGATCAAGACGCGATCCCGCGCCAAGCAGAATCCAGACCAGTACACGGTGATACCGGCG
ACGCTGAAGATCATCAAGGTGCTGATCGAGGAGCTTCTGTCAGCGTCCGGGGCGCAGGCGGCGGCCAACGCAGCC
TCGGCGGCCATTGCGGCACACGGCGAGACCGAGGCAGGCGACGACGATGACGGGTGGGAAGACGACGACGATACG
CTGGACCTCAGCCTCGGGGCCTCCAAGTCGGACCTCTTGTTCTTCTCGGACGCGGGCGGGCGGAGGCAGCGAGAC
GACGAGACGCAGGCGTACCTGACGGACTTTTTCATGCGGTGCGCGAGGGAGAATGTGGCCGGCTTCCAGGACTGG
TACGGCATGTTGACGGAGGAGGAAAAGGCCAAGCTGAACCGGTTGGCGGGACAGTAG
Transcript >Ophun1|2044
ATGGAGGACCAGCTCGTGCAGCTGCTCGCCAACACGCAGCTGGCCGACCAGGTGCCGCGCAGACAGGCCGAGATG
GAGCTCTCACGGGCCGAGACGAACCCGGCGTTTCCCGTCTGCCTGGCCAATATTGCCTCGCACGCGTCTGTCGTC
ACGGCCGTTCGCCAGTCGGCCTTGACGACGCTTCGACTCTTCATCGAGCGGAACTGGGCCGACGAGGACGCTTCC
GACGGTACGCCCGTGCCGATTGCCGACGAGGCTCGGCTATTGCTCAAGCAATCCTTGCTCGACCTTGCTCTTGGT
CTCGATGAGGACCGCAAGGTCAAGATTGCTGCCAGCTACGCTGTTGGAAAAATCGCCATCCACGACTTTCCCGAT
CAATGGCCGACCCTCCTCCCGACGGTCCTCGGCGTCATGCCCTCGGGCACCGACTCTCAGCTGCACGGCGCGCTG
CGTGTGCTGGGAGACCTCGTCGAGGAGAGCCTGAGCGAGGACCAGTTCTTCTCCATGGCCCGCGACATTGCCGAT
GCCCTGACGCGCGTGGCCCTCGACGGCTCCCGCAAGCCCATGCTCCGAGCACTCGCCGTCTCCGTCTTTCGCGGA
TGCATTGACCTCATGAACATGGTCAAAGATAGCCACGCGCAAGAGGTTGATGCGTTCGCAAAGCAGCTGCTCGAG
GGCGACGCCGGCTCCTCGGCCGCCTGGATCCCCTTCTTCATCTCGATTATCCGGGAGCCGTTGCCCCCAGCCGAC
CTAACGGATGGCCAGCCCGAGGAGTGGAATAGCATCGTCGCGCTCAAGCTGCAAGTCGTCAAGACGCTGATCCGA
CTGAGGCGCGCCTTTGCCAACCTCCTATCTCCCCACAGCACCACGCTCTTCAGCGCTGTTTGGGACGAGCTCACC
AATATGCAGGAGCCCCACGATCAGCTCTACATCCAGGCTAATGCCCAGGGGAGACTCGAGGACTCGGACAACCTG
CCCTACACGCTCGACTTTCTCGTCCTCGAGGAGCTCGACTTCCTGAACCAGTGCTTCCGCGCGCCCCGTGTCAAG
GCCGAGCTCGACTCGCAGCTGAATGCACACGCATCCGCCCAGGACGTGCCGTGGATGGTCCAGATCATGACGATG
CTCGTCAACTACGCCCGTGTCACGCGCGAGGAGGAGGAGCTGTGGGACATTGACTGCTCGCTCTACCTGGCCGAG
GAGACGTCGGTGACGGCAAATTACACGGCGCGGACGGCGGCCGGCGATCTGCTCATCAAAATGGGCGAGTGGTTC
GATCAAAAGACCATCGACGGCCTCTACGGTTGCACGAGAGGCCTCTTCCCCGGCAGCGACGACTCATCGTGGCGC
CGCCAAGAGTCCGCCCTGTACCTGTTCGTCATGCTGCTCAGCGACATGCAGGACCTGGGCAAGACCGTCTCGGAG
CCCGTCGCCGTCGAGTACTACAAGCTGGTGGACCTGGCCATCTCAAAGGCCGACAAGCCGCTGCTGCGCGCCCGG
GGCTATCTGGTGGCCGGCATGCTCGGCCAGAACTTTCCGCTGCCGTCGGTGCAGCCGAGCCCGACGAGCGCGGCC
GAGTCCCTGCTGGACCACATGATCAAGGCCATCACGGGCAAGCAGTCGGAGGTGGTGCAGGTCGCCTGCGTCAAG
GCCGTCGAGGGCCTCGTCAGGGCCGAGAGGGTGAGCCTCGACAAGCAGGCGCCCGTCATCGCCGCCATACAGTCG
TACATGAACAGCAAGGACCCGGGCGACATGGAGGAGGCGGACGAGCTGCTGGTGACGCTGGCCGAGGCGCTCAAG
GCGGCCATCATGATGAACACCGAGGTTGCGCTCTCGACAGAGGTCCAGCCCATCGACATGCTCTTCCTGCTGGCC
AAGCTGGGAGCCAGCAACTTTCAGGTGACGGTGCTGGTCTCGGAAGCCTTTGAGGAGATTGTCAAGGCGCTGTCG
AGCGGGCCCTCGTTCGGCGCCCTCTGCGCCAAGACGCTGCCGACGCTGACGGGCGCCTTTGACGTGGCGAACCTG
ACGGACGACAACCCGCTGGTGACGGTGGCGACGGAGCTGCTGGCCGTCCTGGCCGAGCACGGGTCCGAACCCCTG
CCCGAGGGCTTCGTGGCGGCGACTCTTCCCAAGCTCAGCCGGCTGTTGATGGAGTCGAACGAGGGCGAAGTGCTG
CGTCCGGGCTCGGAGACGGTCAAATGGATCCTGATGCACGACCACCAGCAGGTGTTTGGCTGGCAAGACGCCAAC
GGGGTCTCGGGGCTGGAGGTGTGCCTGCGCATCATCGACCGGCTGCTGAAGCCCGAGATCGAGGACAACTCGGCC
TCCGAGGTGGGCGGACTGGCGGCCGAGCTGGTGGAAAAGGCGGGCCAGGAGCGGCTCGGACCGTTTCTGCCCCAG
CTGTTGCAGGCGGTGGCGACGCGCGTGGATTCGGCTCAGGCGGCGGCCTTCATCCAGTCGCTGATCCTGGTGTTT
GCGCGGCTCTCGTTGACGGGCGCCCACGACGTGGTCGAGTTCCTCAGCCAGCTGCAGATCAACGGTCAGAGCGGA
CTCCAGATTGTGCTGGCCAAGTGGCTGGAGAACTCGGTCAGCTTTGCGGGATACGACGAGATTCGACAAAATGTC
ATTGCGCTTTCGAAACTGTACTCGCTCAACGACGCCCGGCTGTCGCAGATCATGGTCAAGGGCGACTTGATGGTG
GGCGGCGACGATGGGAGGATCAAGACGCGATCCCGCGCCAAGCAGAATCCAGACCAGTACACGGTGATACCGGCG
ACGCTGAAGATCATCAAGGTGCTGATCGAGGAGCTTCTGTCAGCGTCCGGGGCGCAGGCGGCGGCCAACGCAGCC
TCGGCGGCCATTGCGGCACACGGCGAGACCGAGGCAGGCGACGACGATGACGGGTGGGAAGACGACGACGATACG
CTGGACCTCAGCCTCGGGGCCTCCAAGTCGGACCTCTTGTTCTTCTCGGACGCGGGCGGGCGGAGGCAGCGAGAC
GACGAGACGCAGGCGTACCTGACGGACTTTTTCATGCGGTGCGCGAGGGAGAATGTGGCCGGCTTCCAGGACTGG
TACGGCATGTTGACGGAGGAGGAAAAGGCCAAGCTGAACCGGTTGGCGGGACAGTAG
Gene >Ophun1|2044
ATGGAGGACCAGCTCGTGCAGCTGCTCGCCAACACGCAGCTGGCCGACCAGGTGCCGCGCAGACAGGCCGAGATG
GAGCTCTCACGGGCCGAGACGAACCCGGCGTTTCCCGTCTGCCTGGCCAATATTGCCTCGCACGCGTCTGTCGTC
ACGGCCGTTCGCCAGTCGGCCTTGACGACGCTTCGACTCTTCATCGAGCGGAACTGGGCCGACGAGGACGCTTCC
GACGGTACGCCCGTGCCGATTGCCGACGAGGCTCGGCTATTGCTCAAGCAATCCTTGCTCGACCTTGCTCTTGGT
CTCGATGAGGACCGCAAGGTCAAGATTGCTGCCAGGTGCGTCTCCTCACTACTCCCCTTCTTCTCCCCTTGCCCT
GTCAAAAGCATCTCTAACTAGTCAACTCCGTTGTATTAGCTACGCTGTTGGAAAAATCGCCATCCACGACTTTCC
CGATCAATGGCCGACCCTCCTCCCGACGGTCCTCGGCGTCATGCCCTCGGGCACCGACTCTCAGCTGCACGGCGC
GCTGCGTGTGCTGGGAGACCTCGTCGAGGAGAGCCTGAGCGAGGACCAGTTCTTCTCCATGGCCCGCGACATTGC
CGATGCCCTGACGCGCGTGGCCCTCGACGGCTCCCGCAAGCCCATGCTCCGAGCACTCGCCGTCTCCGTCTTTCG
CGGATGCATTGACCTCATGAACATGGTCAAAGATAGCCACGCGCAAGAGGTTGATGCGTTCGCAAAGCAGCTGCT
CGAGGGCGACGCCGGCTCCTCGGCCGCCTGGATCCCCTTCTTCATCTCGATTATCCGGGAGCCGTTGCCCCCAGC
CGACCTAACGGATGGCCAGCCCGAGGAGTGGAATAGCATCGTCGCGCTCAAGCTGCAAGTCGTCAAGACGCTGAT
CCGACTGAGGCGCGCCTTTGCCAACCTCCTATCTCCCCACAGCACCACGCTCTTCAGCGCTGTTTGGGACGAGCT
CACCAATATGCAGGAGCCCCACGATCAGCTCTACATCCAGGCTAATGCCCAGGGGAGACTCGAGGACTCGGACAA
CCTGCCCTACACGCTCGACTTTCTCGTCCTCGAGGAGCTCGACTTCCTGAACCAGTGCTTCCGCGCGCCCCGTGT
CAAGGCCGAGCTCGACTCGCAGCTGAATGCACACGCATCCGCCCAGGACGTGCCGTGGATGGTCCAGATCATGAC
GATGCTCGTCAACTACGCCCGTGTCACGCGCGAGGAGGAGGAGCTGTGGGACATTGACTGCTCGCTCTACCTGGC
CGAGGAGACGTCGGTGACGGCAAATTACACGGCGCGGACGGCGGCCGGCGATCTGCTCATCAAAATGGGCGAGTG
GTTCGATCAAAAGACCATCGACGGCCTCTACGGTTGCACGAGAGGCCTCTTCCCCGGCAGCGACGACTCATCGTG
GCGCCGCCAAGAGTCCGCCCTGTACCTGTTCGTCATGCTGCTCAGCGACATGCAGGACCTGGGCAAGACCGTCTC
GGAGCCCGTCGCCGTCGAGTACTACAAGCTGGTGGACCTGGCCATCTCAAAGGCCGACAAGCCGCTGCTGCGCGC
CCGGGGCTATCTGGTGGCCGGCATGCTCGGCCAGAACTTTCCGCTGCCGTCGGTGCAGCCGAGCCCGACGAGCGC
GGCCGAGTCCCTGCTGGACCACATGATCAAGGCCATCACGGGCAAGCAGTCGGAGGTGGTGCAGGTCGCCTGCGT
CAAGGCCGTCGAGGGCCTCGTCAGGGCCGAGAGGGTGAGCCTCGACAAGCAGGCGCCCGTCATCGCCGCCATACA
GTCGTACATGAACAGCAAGGACCCGGGCGACATGGAGGAGGCGGACGAGCTGCTGGTGACGCTGGCCGAGGCGCT
CAAGGCGGCCATCATGATGAACACCGAGGTTGCGCTCTCGACAGAGGTCCAGCCCATCGACATGCTCTTCCTGCT
GGCCAAGCTGGGAGCCAGCAACTTTCAGGTGACGGTGCTGGTCTCGGAAGCCTTTGAGGAGATTGTCAAGGCGCT
GTCGAGCGGGCCCTCGTTCGGCGCCCTCTGCGCCAAGACGCTGCCGACGCTGACGGGCGCCTTTGACGTGGCGAA
CCTGACGGACGACAACCCGCTGGTGACGGTGGCGACGGAGCTGCTGGCCGTCCTGGCCGAGCACGGGTCCGAACC
CCTGCCCGAGGGCTTCGTGGCGGCGACTCTTCCCAAGCTCAGCCGGCTGTTGATGGAGTCGAACGAGGGCGAAGT
GCTGCGTCCGGGCTCGGAGACGGTCAAATGGATCCTGATGCACGACCACCAGCAGGTGTTTGGCTGGCAAGACGC
CAACGGGGTCTCGGGGCTGGAGGTGTGCCTGCGCATCATCGACCGGCTGCTGAAGCCCGAGATCGAGGACAACTC
GGCCTCCGAGGTGGGCGGACTGGCGGCCGAGCTGGTGGAAAAGGCGGGCCAGGAGCGGCTCGGACCGTTTCTGCC
CCAGCTGTTGCAGGCGGTGGCGACGCGCGTGGATTCGGCTCAGGCGGCGGCCTTCATCCAGTCGCTGATCCTGGT
GTTTGCGCGGCTCTCGTTGACGGGCGCCCACGACGTGGTCGAGTTCCTCAGCCAGCTGCAGATCAACGGTCAGAG
CGGACTCCAGATTGTGCTGGCCAAGTGGCTGGAGAACTCGGTCAGCTTTGCGGGATACGACGAGATTCGACAAAA
GTGAGTGGACCCCTATAACTTGGTGGCTCTGCTAACAGCAGTCAGTGTCATTGCGCTTTCGAAACTGTACTCGCT
CAACGACGCCCGGCTGTCGCAGATCATGGTCAAGGGCGACTTGATGGTGGGCGGCGACGATGGGAGGATCAAGAC
GCGATCCCGCGCCAAGCAGAGTATGTTGAGCCTGGCCTGGTTGCTGGGGTGGTCGGAAGGGGCTGAAGCAAGCTA
CGCAGATCCAGACCAGTACACGGTGATACCGGCGACGCTGAAGATCATCAAGGTGCTGATCGAGGAGCTTCTGTC
AGCGTCCGGGGCGCAGGCGGCGGCCAACGCAGCCTCGGCGGCCATTGCGGCACACGGCGAGACCGAGGCAGGCGA
CGACGATGACGGGTGGGAAGACGACGACGATACGCTGGACCTCAGCCTCGGGGCCTCCAAGTCGGACCTCTTGTT
CTTCTCGGACGCGGGCGGGCGGAGGCAGCGAGACGACGAGACGCAGGCGTACCTGACGGACTTTTTCATGCGGTG
CGCGAGGGAGAATGTGGCCGGCTTCCAGGACTGGTACGGCATGTTGACGGAGGAGGAAAAGGCCAAGCTGAACCG
GTTGGCGGGACAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail