Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2042
Gene name
LocationContig_195:18368..21080
Strand+
Gene length (bp)2712
Transcript length (bp)2667
Coding sequence length (bp)2667
Protein length (aa) 889

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03835 Rad4 Rad4 transglutaminase-like domain 8.2E-28 413 572
PF10405 BHD_3 Rad4 beta-hairpin domain 3 2.6E-26 715 786
PF10403 BHD_1 Rad4 beta-hairpin domain 1 3.0E-20 585 642
PF10404 BHD_2 Rad4 beta-hairpin domain 2 3.5E-15 646 708

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P87235|RHP42_SCHPO DNA repair protein rhp42 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rhp42 PE=3 SV=1 434 830 8.0E-75
sp|Q10445|RHP41_SCHPO DNA repair protein rhp41 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rhp41 PE=3 SV=1 88 830 4.0E-60
sp|Q24595|XPC_DROME DNA repair protein complementing XP-C cells homolog OS=Drosophila melanogaster GN=Xpc PE=1 SV=2 432 830 1.0E-32
sp|Q01831|XPC_HUMAN DNA repair protein complementing XP-C cells OS=Homo sapiens GN=XPC PE=1 SV=4 444 830 3.0E-30
sp|P14736|RAD4_YEAST DNA repair protein RAD4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD4 PE=1 SV=3 438 846 2.0E-28
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P87235|RHP42_SCHPO DNA repair protein rhp42 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rhp42 PE=3 SV=1 434 830 8.0E-75
sp|Q10445|RHP41_SCHPO DNA repair protein rhp41 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rhp41 PE=3 SV=1 88 830 4.0E-60
sp|Q24595|XPC_DROME DNA repair protein complementing XP-C cells homolog OS=Drosophila melanogaster GN=Xpc PE=1 SV=2 432 830 1.0E-32
sp|Q01831|XPC_HUMAN DNA repair protein complementing XP-C cells OS=Homo sapiens GN=XPC PE=1 SV=4 444 830 3.0E-30
sp|P14736|RAD4_YEAST DNA repair protein RAD4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD4 PE=1 SV=3 438 846 2.0E-28
sp|P51612|XPC_MOUSE DNA repair protein complementing XP-C cells homolog OS=Mus musculus GN=Xpc PE=1 SV=2 444 830 4.0E-27
sp|Q8W489|RAD4_ARATH DNA repair protein RAD4 OS=Arabidopsis thaliana GN=RAD4 PE=1 SV=1 438 839 5.0E-20
sp|P87235|RHP42_SCHPO DNA repair protein rhp42 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rhp42 PE=3 SV=1 139 358 1.0E-12
sp|Q06665|RAD34_YEAST DNA repair protein RAD34 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD34 PE=1 SV=1 429 832 3.0E-12
[Show less]

GO

GO Term Description Terminal node
GO:0003677 DNA binding Yes
GO:0097159 organic cyclic compound binding No
GO:0003674 molecular_function No
GO:0003676 nucleic acid binding No
GO:1901363 heterocyclic compound binding No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 37 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2042
MSPRVLRKRPRESQETKGKGKAPPSTPEPARKKPKTSLYHDLDASVTPKSGKESVLKGIVEDSDSSLTSLSELDA
ATVAGAQSKDDDDDDDDDDDDDDIAFEDVAVPSDAAEEAPVVSGDLELTLQKDTRISLTNPYGNKKGPSKRERSV
RNATHCLHVMSLLFHNAVRSSWLCDQEVQATMISHLPRSIWAEFDRWKRSSGLSTSVEPCETPKKNKDSPERASR
NWSLAAAKLEEGAVDMSRGDPLFRLMQSLAAWWKQRFRITAHGLRKRGYMALERLDRLTKAFEAAQGEGALFGER
IPGLEAFRERARACQGSRDVGAQLFTALLRGLGLEARMVANLPCLGFGWNKLEDADPEKEEDDKLASATAEKPAA
KKSSRAGKQTKAQPAVKARSSRRAIPKEALRAQGSDSAESDDEKLYKQYMKATKPTGKLDNDLEYPHYWSEVLSP
VTNKYVAVDALKGTIATNRDHFETFEPRGAKADRARQIMAYIVGYSPDGTAKDVTVRYLKRRVLPGRTRGARMPP
EKVAVYDSRGKVKRHEQLDWFKTAMSGYRRGGKLHPLTDADHDEDATDLKPAEAVKKEVKEGEETVQYYKQSSEF
VLERHLKREEALKEGAVPVKVFRNKAKGSKGEEEDVFLRADVVQVKSAETWHKQGRAPRAGEQPLKRVPYRAATL
NRRREIVEAEAATGEKVLQGLFSLEQTDWIIPPPIKDGVIPKNEYGNIDLFAEHMCPEGAVHVPYRGAVRVCKRL
EVDFAEAVVGFEFGNRMAVPVISGVVVAVEHHERVMQELATDEAERARREDEKRRKAALGKWRKFIMGLRIASRI
RRDYGEVEERRDEVLPGGFLPEGFEEEEEGGEGGERSGFFPVGGDDEEEEEEDGDGVLTVEDA*
Coding >Ophun1|2042
ATGAGTCCTCGGGTTCTGCGTAAGCGTCCGCGCGAATCGCAAGAAACCAAGGGTAAAGGCAAAGCACCACCTTCG
ACTCCGGAGCCGGCTCGCAAGAAGCCCAAGACGAGCCTATACCACGACCTCGACGCCTCCGTCACGCCCAAGTCG
GGCAAAGAATCTGTGTTGAAGGGTATTGTCGAAGATAGCGACAGCTCATTGACATCTCTGTCGGAGTTGGACGCG
GCGACTGTCGCTGGAGCTCAGTCGAAAGACGATGACGATGACGATGACGATGACGATGACGATGACGACATCGCC
TTCGAGGACGTGGCGGTTCCTTCTGACGCTGCAGAAGAGGCTCCCGTCGTATCAGGAGACCTCGAGCTGACGCTA
CAAAAAGACACGCGCATCTCGCTCACCAACCCCTATGGCAACAAAAAGGGCCCTTCCAAGCGAGAACGCAGCGTA
CGCAACGCAACACACTGCCTCCACGTCATGTCGCTACTCTTCCACAACGCCGTCCGCAGCTCGTGGCTCTGCGAC
CAAGAGGTTCAAGCCACGATGATATCCCACTTGCCCAGGAGCATCTGGGCCGAATTCGACCGCTGGAAACGCAGC
TCTGGTCTGAGCACGTCAGTCGAACCCTGTGAGACGCCGAAGAAGAACAAAGACTCTCCTGAACGTGCTTCGCGC
AATTGGAGCTTGGCGGCCGCGAAGCTGGAAGAGGGCGCAGTGGATATGAGCCGCGGAGACCCCCTCTTCCGTCTA
ATGCAGTCGCTGGCAGCTTGGTGGAAGCAGCGCTTTCGCATCACGGCTCACGGTCTGAGAAAACGGGGCTATATG
GCGTTGGAGCGGTTGGATCGACTGACCAAGGCCTTTGAGGCTGCGCAGGGGGAGGGTGCCTTGTTTGGCGAGAGG
ATACCGGGTCTCGAGGCGTTTCGCGAACGTGCCCGTGCCTGTCAGGGGAGCCGTGATGTCGGGGCCCAACTGTTC
ACTGCGCTGCTCAGGGGGCTGGGACTTGAAGCTCGGATGGTGGCCAACCTTCCGTGCCTGGGCTTTGGATGGAAT
AAGCTCGAGGATGCGGATCCTGAAAAGGAGGAAGATGACAAGCTTGCGTCTGCGACTGCTGAGAAGCCAGCGGCG
AAGAAGAGTTCGCGCGCTGGCAAGCAGACGAAGGCTCAGCCGGCTGTCAAGGCTCGGAGCTCGCGCCGTGCAATT
CCGAAGGAGGCATTGCGAGCTCAGGGCAGCGATTCCGCCGAGTCGGATGACGAGAAGCTGTACAAGCAGTACATG
AAAGCGACAAAACCGACCGGAAAGCTTGACAACGATCTCGAGTACCCTCACTACTGGTCAGAAGTGCTGTCACCC
GTCACCAACAAATACGTTGCTGTCGATGCTTTAAAGGGCACAATCGCCACGAACCGAGACCACTTCGAGACGTTC
GAGCCCCGGGGCGCCAAGGCCGACAGGGCGAGACAGATCATGGCCTACATCGTCGGATACTCGCCAGACGGCACA
GCCAAAGACGTGACGGTGCGCTATCTCAAGCGACGCGTTCTCCCTGGGCGGACTAGAGGCGCGAGGATGCCGCCG
GAAAAGGTTGCCGTCTACGACAGCCGCGGCAAGGTGAAGCGGCACGAGCAGCTGGACTGGTTCAAGACGGCCATG
TCGGGATACAGACGAGGCGGTAAACTGCATCCTCTCACAGACGCGGACCACGATGAGGATGCGACGGACCTTAAG
CCGGCCGAGGCAGTCAAGAAGGAGGTCAAAGAGGGCGAGGAGACGGTTCAATACTACAAGCAATCGAGCGAGTTC
GTGTTGGAGAGACACCTCAAGCGGGAAGAGGCTCTCAAAGAGGGAGCGGTACCTGTCAAGGTGTTTAGAAACAAG
GCAAAAGGCAGCAAAGGCGAGGAAGAAGACGTCTTCCTACGCGCCGACGTCGTTCAGGTAAAGAGTGCCGAAACG
TGGCACAAACAGGGGAGGGCACCAAGGGCGGGCGAGCAGCCGCTGAAGAGAGTGCCTTACCGGGCCGCCACGCTC
AACCGGCGGAGGGAGATTGTCGAGGCGGAGGCGGCGACGGGGGAAAAGGTGCTTCAGGGGCTGTTTAGCCTGGAG
CAGACGGACTGGATTATCCCGCCGCCCATCAAAGACGGCGTGATTCCCAAGAATGAATACGGGAACATTGATCTC
TTTGCGGAGCACATGTGCCCTGAAGGCGCCGTACATGTCCCTTACAGGGGCGCGGTCCGGGTCTGCAAGCGACTC
GAGGTAGACTTTGCCGAGGCGGTGGTAGGCTTCGAGTTCGGGAACCGGATGGCTGTGCCGGTGATATCAGGCGTC
GTCGTGGCAGTTGAGCACCACGAGCGCGTCATGCAAGAGCTAGCCACCGACGAGGCAGAGAGGGCACGACGCGAA
GACGAGAAGCGACGCAAGGCGGCGCTCGGGAAGTGGCGGAAGTTCATCATGGGCTTGCGTATCGCGAGCCGGATA
AGACGCGATTATGGGGAGGTGGAGGAGCGGCGTGATGAGGTCTTGCCGGGGGGGTTCTTGCCGGAGGGGTTTGAG
GAGGAGGAGGAGGGGGGTGAGGGGGGTGAGCGGTCTGGGTTCTTTCCGGTTGGTGGTGATGATGAGGAGGAGGAG
GAGGAGGATGGGGATGGGGTTCTGACGGTGGAAGATGCTTGA
Transcript >Ophun1|2042
ATGAGTCCTCGGGTTCTGCGTAAGCGTCCGCGCGAATCGCAAGAAACCAAGGGTAAAGGCAAAGCACCACCTTCG
ACTCCGGAGCCGGCTCGCAAGAAGCCCAAGACGAGCCTATACCACGACCTCGACGCCTCCGTCACGCCCAAGTCG
GGCAAAGAATCTGTGTTGAAGGGTATTGTCGAAGATAGCGACAGCTCATTGACATCTCTGTCGGAGTTGGACGCG
GCGACTGTCGCTGGAGCTCAGTCGAAAGACGATGACGATGACGATGACGATGACGATGACGATGACGACATCGCC
TTCGAGGACGTGGCGGTTCCTTCTGACGCTGCAGAAGAGGCTCCCGTCGTATCAGGAGACCTCGAGCTGACGCTA
CAAAAAGACACGCGCATCTCGCTCACCAACCCCTATGGCAACAAAAAGGGCCCTTCCAAGCGAGAACGCAGCGTA
CGCAACGCAACACACTGCCTCCACGTCATGTCGCTACTCTTCCACAACGCCGTCCGCAGCTCGTGGCTCTGCGAC
CAAGAGGTTCAAGCCACGATGATATCCCACTTGCCCAGGAGCATCTGGGCCGAATTCGACCGCTGGAAACGCAGC
TCTGGTCTGAGCACGTCAGTCGAACCCTGTGAGACGCCGAAGAAGAACAAAGACTCTCCTGAACGTGCTTCGCGC
AATTGGAGCTTGGCGGCCGCGAAGCTGGAAGAGGGCGCAGTGGATATGAGCCGCGGAGACCCCCTCTTCCGTCTA
ATGCAGTCGCTGGCAGCTTGGTGGAAGCAGCGCTTTCGCATCACGGCTCACGGTCTGAGAAAACGGGGCTATATG
GCGTTGGAGCGGTTGGATCGACTGACCAAGGCCTTTGAGGCTGCGCAGGGGGAGGGTGCCTTGTTTGGCGAGAGG
ATACCGGGTCTCGAGGCGTTTCGCGAACGTGCCCGTGCCTGTCAGGGGAGCCGTGATGTCGGGGCCCAACTGTTC
ACTGCGCTGCTCAGGGGGCTGGGACTTGAAGCTCGGATGGTGGCCAACCTTCCGTGCCTGGGCTTTGGATGGAAT
AAGCTCGAGGATGCGGATCCTGAAAAGGAGGAAGATGACAAGCTTGCGTCTGCGACTGCTGAGAAGCCAGCGGCG
AAGAAGAGTTCGCGCGCTGGCAAGCAGACGAAGGCTCAGCCGGCTGTCAAGGCTCGGAGCTCGCGCCGTGCAATT
CCGAAGGAGGCATTGCGAGCTCAGGGCAGCGATTCCGCCGAGTCGGATGACGAGAAGCTGTACAAGCAGTACATG
AAAGCGACAAAACCGACCGGAAAGCTTGACAACGATCTCGAGTACCCTCACTACTGGTCAGAAGTGCTGTCACCC
GTCACCAACAAATACGTTGCTGTCGATGCTTTAAAGGGCACAATCGCCACGAACCGAGACCACTTCGAGACGTTC
GAGCCCCGGGGCGCCAAGGCCGACAGGGCGAGACAGATCATGGCCTACATCGTCGGATACTCGCCAGACGGCACA
GCCAAAGACGTGACGGTGCGCTATCTCAAGCGACGCGTTCTCCCTGGGCGGACTAGAGGCGCGAGGATGCCGCCG
GAAAAGGTTGCCGTCTACGACAGCCGCGGCAAGGTGAAGCGGCACGAGCAGCTGGACTGGTTCAAGACGGCCATG
TCGGGATACAGACGAGGCGGTAAACTGCATCCTCTCACAGACGCGGACCACGATGAGGATGCGACGGACCTTAAG
CCGGCCGAGGCAGTCAAGAAGGAGGTCAAAGAGGGCGAGGAGACGGTTCAATACTACAAGCAATCGAGCGAGTTC
GTGTTGGAGAGACACCTCAAGCGGGAAGAGGCTCTCAAAGAGGGAGCGGTACCTGTCAAGGTGTTTAGAAACAAG
GCAAAAGGCAGCAAAGGCGAGGAAGAAGACGTCTTCCTACGCGCCGACGTCGTTCAGGTAAAGAGTGCCGAAACG
TGGCACAAACAGGGGAGGGCACCAAGGGCGGGCGAGCAGCCGCTGAAGAGAGTGCCTTACCGGGCCGCCACGCTC
AACCGGCGGAGGGAGATTGTCGAGGCGGAGGCGGCGACGGGGGAAAAGGTGCTTCAGGGGCTGTTTAGCCTGGAG
CAGACGGACTGGATTATCCCGCCGCCCATCAAAGACGGCGTGATTCCCAAGAATGAATACGGGAACATTGATCTC
TTTGCGGAGCACATGTGCCCTGAAGGCGCCGTACATGTCCCTTACAGGGGCGCGGTCCGGGTCTGCAAGCGACTC
GAGGTAGACTTTGCCGAGGCGGTGGTAGGCTTCGAGTTCGGGAACCGGATGGCTGTGCCGGTGATATCAGGCGTC
GTCGTGGCAGTTGAGCACCACGAGCGCGTCATGCAAGAGCTAGCCACCGACGAGGCAGAGAGGGCACGACGCGAA
GACGAGAAGCGACGCAAGGCGGCGCTCGGGAAGTGGCGGAAGTTCATCATGGGCTTGCGTATCGCGAGCCGGATA
AGACGCGATTATGGGGAGGTGGAGGAGCGGCGTGATGAGGTCTTGCCGGGGGGGTTCTTGCCGGAGGGGTTTGAG
GAGGAGGAGGAGGGGGGTGAGGGGGGTGAGCGGTCTGGGTTCTTTCCGGTTGGTGGTGATGATGAGGAGGAGGAG
GAGGAGGATGGGGATGGGGTTCTGACGGTGGAAGATGCTTGA
Gene >Ophun1|2042
ATGAGTCCTCGGGTTCTGCGTAAGCGTCCGCGCGAATCGCAAGAAACCAAGGGTAAAGGCAAAGCACCACCTTCG
ACTCCGGAGCCGGCTCGCAAGAAGCCCAAGACGAGCCTATACCACGACCTCGACGCCTCCGTCACGCCCAAGTCG
GGCAAAGAATCTGTGTTGAAGGGTATTGTCGAAGATAGCGACAGCTCATTGACATCTCTGTCGGAGTTGGACGCG
GCGACTGTCGCTGGAGCTCAGTCGAAAGACGATGACGATGACGATGACGATGACGATGACGATGACGACATCGCC
TTCGAGGACGTGGCGGTTCCTTCTGACGCTGCAGAAGAGGCTCCCGTCGTATCAGGAGACCTCGAGCTGACGCTA
CAAAAAGACACGCGCATCTCGCTCACCAACCCCTATGGCAACAAAAAGGGCCCTTCCAAGCGAGAACGCAGCGTA
CGCAACGCAACACACTGCCTCCACGTCATGTCGCTACTCTTCCACAACGCCGTCCGCAGCTCGTGGCTCTGCGAC
CAAGAGGTTCAAGCCACGATGATATCCCACTTGCCCAGGAGCATCTGGGCCGAATTCGACCGCTGGAAACGCAGC
TCTGGTCTGAGCACGTCAGTCGAACCCTGTGAGACGCCGAAGAAGAACAAAGACTCTCCTGAACGTGCTTCGCGC
AATTGGAGCTTGGCGGCCGCGAAGCTGGAAGAGGGCGCAGTGGATATGAGCCGCGGAGACCCCCTCTTCCGTCTA
ATGCAGTCGCTGGCAGCTTGGTGGAAGCAGCGCTTTCGCATCACGGCTCACGGTCTGAGAAAACGGGGCTATATG
GCGTTGGAGCGGTTGGATCGACTGACCAAGGCCTTTGAGGCTGCGCAGGGGGAGGGTGCCTTGTTTGGCGAGAGG
ATACCGGGTCTCGAGGCGTTTCGCGAACGTGCCCGTGCCTGTCAGGGGAGCCGTGATGTCGGGGCCCAACTGTTC
ACTGCGCTGCTCAGGGGGCTGGGACTTGAAGCTCGGATGGTGGCCAACCTTCCGTGCCTGGGCTTTGGATGGAAT
AAGCTCGAGGATGCGGATCCTGAAAAGGAGGAAGATGACAAGCTTGCGTCTGCGACTGCTGAGAAGCCAGCGGCG
AAGAAGAGTTCGCGCGCTGGCAAGCAGACGAAGGCTCAGCCGGCTGTCAAGGCTCGGAGCTCGCGCCGTGCAATT
CCGAAGGAGGCATTGCGAGCTCAGGGCAGCGATTCCGCCGAGTCGGATGACGAGAAGCTGTACAAGCAGTACATG
AAAGCGACAAAACCGACCGGAAAGCTTGACAACGATCTCGAGTACCCTCACTACTGGTCAGAAGTGCTGTCACCC
GTCACCAACAAATACGTTGCTGTCGATGCTTTAAAGGGCACAATCGCCACGAACCGAGACCACTTCGAGACGTTC
GAGCCCCGGGGCGCCAAGGCCGACAGGGCGAGACAGATCATGGCCTACATCGTCGGATACTCGCCAGACGGCACA
GCCAAAGACGTGACGGTGCGCTATCTCAAGCGACGCGTTCTCCCTGGGCGGACTAGAGGCGCGAGGATGCCGCCG
GAAAAGGTTGCCGTCTACGACAGCCGCGGCAAGGTGAAGCGGCACGAGCAGCTGGACTGGTTCAAGACGGCCATG
TCGGGATACAGACGAGGCGGTAAACTGCATCCTCTCACAGACGCGGACCACGATGAGGATGCGACGGACCTTAAG
CCGGCCGAGGCAGTCAAGAAGGAGGTCAAAGAGGGCGAGGAGACGGTTCAATACTACAAGCAATCGAGCGAGTTC
GTGTTGGAGAGACACCTCAAGCGGGAAGAGGCTCTCAAAGAGGGAGCGGTACCTGTCAAGGTGTTTAGAAACAAG
GCAAAAGGCAGCAAAGGCGAGGAAGAAGACGTCTTCCTACGCGCCGACGTCGTTCAGGTAAAGAGTGCCGAAACG
TGGCACAAACAGGGGAGGGCACCAAGGGCGGGCGAGCAGCCGCTGAAGAGAGTGCCTTACCGGGCCGCCACGCTC
AACCGGCGGAGGGAGATTGTCGAGGCGGAGGCGGCGACGGGGGAAAAGGTGCTTCAGGGGCTGTTTAGCCTGGAG
CAGACGGACTGGATTATCCCGCCGCCCATCAAAGACGGCGTGATTCCCAAGAATGAATACGGGTAAGGCACCTCT
TCTGCTGTCTGAGCTGGCTGACGCGAGATTAGGAACATTGATCTCTTTGCGGAGCACATGTGCCCTGAAGGCGCC
GTACATGTCCCTTACAGGGGCGCGGTCCGGGTCTGCAAGCGACTCGAGGTAGACTTTGCCGAGGCGGTGGTAGGC
TTCGAGTTCGGGAACCGGATGGCTGTGCCGGTGATATCAGGCGTCGTCGTGGCAGTTGAGCACCACGAGCGCGTC
ATGCAAGAGCTAGCCACCGACGAGGCAGAGAGGGCACGACGCGAAGACGAGAAGCGACGCAAGGCGGCGCTCGGG
AAGTGGCGGAAGTTCATCATGGGCTTGCGTATCGCGAGCCGGATAAGACGCGATTATGGGGAGGTGGAGGAGCGG
CGTGATGAGGTCTTGCCGGGGGGGTTCTTGCCGGAGGGGTTTGAGGAGGAGGAGGAGGGGGGTGAGGGGGGTGAG
CGGTCTGGGTTCTTTCCGGTTGGTGGTGATGATGAGGAGGAGGAGGAGGAGGATGGGGATGGGGTTCTGACGGTG
GAAGATGCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail