Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|204
Gene name
LocationContig_104:6343..7474
Strand-
Gene length (bp)1131
Transcript length (bp)975
Coding sequence length (bp)975
Protein length (aa) 325

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03878 YIF1 YIF1 1.3E-98 68 322

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P87148|YIF1_SCHPO Protein transport protein yif1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hrf1 PE=3 SV=1 10 322 4.0E-74
sp|Q6PC24|YIF1A_DANRE Protein YIF1A OS=Danio rerio GN=yif1a PE=2 SV=1 21 289 5.0E-42
sp|Q3T196|YIF1A_BOVIN Protein YIF1A OS=Bos taurus GN=YIF1A PE=2 SV=1 27 290 6.0E-41
sp|Q5U3G6|YIF1B_DANRE Protein YIF1B OS=Danio rerio GN=yif1b PE=2 SV=2 23 322 1.0E-39
sp|O95070|YIF1A_HUMAN Protein YIF1A OS=Homo sapiens GN=YIF1A PE=1 SV=2 27 291 4.0E-39
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P87148|YIF1_SCHPO Protein transport protein yif1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hrf1 PE=3 SV=1 10 322 4.0E-74
sp|Q6PC24|YIF1A_DANRE Protein YIF1A OS=Danio rerio GN=yif1a PE=2 SV=1 21 289 5.0E-42
sp|Q3T196|YIF1A_BOVIN Protein YIF1A OS=Bos taurus GN=YIF1A PE=2 SV=1 27 290 6.0E-41
sp|Q5U3G6|YIF1B_DANRE Protein YIF1B OS=Danio rerio GN=yif1b PE=2 SV=2 23 322 1.0E-39
sp|O95070|YIF1A_HUMAN Protein YIF1A OS=Homo sapiens GN=YIF1A PE=1 SV=2 27 291 4.0E-39
sp|Q4FZQ0|YF1BB_XENLA Protein YIF1B-B OS=Xenopus laevis GN=yif1b-b PE=2 SV=1 66 322 7.0E-39
sp|Q6P301|YIF1B_XENTR Protein YIF1B OS=Xenopus tropicalis GN=yif1b PE=2 SV=1 66 322 1.0E-38
sp|Q6GN58|YF1BA_XENLA Protein YIF1B-A OS=Xenopus laevis GN=yif1b-a PE=2 SV=1 66 322 2.0E-38
sp|Q5BJH7|YIF1B_HUMAN Protein YIF1B OS=Homo sapiens GN=YIF1B PE=1 SV=1 27 322 3.0E-37
sp|Q9CX30|YIF1B_MOUSE Protein YIF1B OS=Mus musculus GN=Yif1b PE=1 SV=2 27 322 5.0E-36
sp|Q91XB7|YIF1A_MOUSE Protein YIF1A OS=Mus musculus GN=Yif1a PE=1 SV=1 28 276 2.0E-35
sp|P53845|YIF1_YEAST Protein transport protein YIF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YIF1 PE=1 SV=1 1 321 1.0E-33
sp|Q6PEC3|YIF1B_RAT Protein YIF1B OS=Rattus norvegicus GN=Yif1b PE=2 SV=2 27 183 2.0E-18
[Show less]

GO

GO Term Description Terminal node
GO:0005789 endoplasmic reticulum membrane Yes
GO:0006888 endoplasmic reticulum to Golgi vesicle-mediated transport Yes
GO:0051179 localization No
GO:0016192 vesicle-mediated transport No
GO:0051649 establishment of localization in cell No
GO:0051234 establishment of localization No
GO:0031090 organelle membrane No
GO:0046907 intracellular transport No
GO:0016020 membrane No
GO:0048193 Golgi vesicle transport No
GO:0051641 cellular localization No
GO:0009987 cellular process No
GO:0005575 cellular_component No
GO:0006810 transport No
GO:0110165 cellular anatomical entity No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 40 0.45

Transmembrane Domains

Domain # Start End Length
1 160 179 19
2 189 211 22
3 224 242 18
4 252 271 19
5 305 322 17

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|204
MQRAPYGQSPPLHHPVPQHVSTVPQLRSPPPPPGSAQSQQQSYGGTPFQQQQGAAGGNMFGGYGQFMNDPAAQVA
AQFGQTAFKHGQEYVEQNVPLGRYVQISALKRYFNVSNSYVVNKLFLVLFPWRHKPWSRKQAVGANGQEGWYLPP
REDINSPDMYIPVMALVTFILLSTLIAGLRGKFQPELLGYTATTGMVVVIVEIVALKLGCFMLSISSQSQLLDLI
AYSGYKFVGIIVTIAVAEISNGGKGTGGWAGWAVFFYTFLANSLFLMRSLKYVLLPETSGNTGGPMQTDSRAKRN
QRTQFLFFYSYIVQFLFMWVLTRA*
Coding >Ophun1|204
ATGCAGCGGGCGCCTTACGGGCAGTCGCCCCCGTTGCACCACCCCGTGCCCCAGCACGTCTCGACGGTCCCCCAG
CTACGGTCACCACCTCCGCCGCCAGGCTCTGCGCAGTCACAACAGCAGAGCTATGGGGGAACGCCCTTCCAGCAG
CAGCAAGGCGCGGCGGGGGGCAACATGTTTGGCGGCTATGGCCAGTTCATGAACGATCCGGCTGCTCAGGTGGCT
GCCCAATTTGGCCAGACGGCTTTTAAGCATGGCCAGGAGTATGTCGAGCAGAATGTACCGCTTGGTCGTTATGTC
CAAATCTCGGCGCTCAAGCGCTACTTCAACGTCTCCAACTCTTACGTCGTCAACAAGCTCTTCCTCGTCCTCTTT
CCCTGGCGGCACAAGCCCTGGTCGCGCAAGCAAGCCGTCGGCGCCAACGGTCAGGAGGGGTGGTATCTGCCTCCT
CGAGAAGATATCAACAGCCCGGACATGTACATTCCAGTCATGGCCCTCGTCACTTTCATTCTCCTCTCGACCCTC
ATTGCCGGCTTAAGAGGCAAGTTTCAGCCGGAGCTGCTGGGGTACACGGCGACGACGGGCATGGTGGTAGTCATT
GTCGAGATTGTCGCCCTCAAGCTGGGCTGCTTCATGTTGAGCATTTCGAGTCAGTCTCAGCTCCTCGATCTGATT
GCCTATTCCGGCTACAAATTTGTCGGCATCATCGTCACCATCGCCGTGGCCGAGATCTCCAACGGCGGAAAGGGC
ACTGGCGGTTGGGCTGGTTGGGCCGTCTTCTTCTATACCTTTTTGGCCAACTCTCTGTTCCTGATGCGATCCCTC
AAATATGTTTTGCTGCCGGAGACGTCCGGAAACACTGGCGGCCCTATGCAGACCGACTCCCGAGCGAAGCGCAAT
CAGAGGACGCAGTTTCTGTTTTTCTATTCATACATTGTTCAGTTTCTCTTCATGTGGGTTCTCACTAGAGCTTAA
Transcript >Ophun1|204
ATGCAGCGGGCGCCTTACGGGCAGTCGCCCCCGTTGCACCACCCCGTGCCCCAGCACGTCTCGACGGTCCCCCAG
CTACGGTCACCACCTCCGCCGCCAGGCTCTGCGCAGTCACAACAGCAGAGCTATGGGGGAACGCCCTTCCAGCAG
CAGCAAGGCGCGGCGGGGGGCAACATGTTTGGCGGCTATGGCCAGTTCATGAACGATCCGGCTGCTCAGGTGGCT
GCCCAATTTGGCCAGACGGCTTTTAAGCATGGCCAGGAGTATGTCGAGCAGAATGTACCGCTTGGTCGTTATGTC
CAAATCTCGGCGCTCAAGCGCTACTTCAACGTCTCCAACTCTTACGTCGTCAACAAGCTCTTCCTCGTCCTCTTT
CCCTGGCGGCACAAGCCCTGGTCGCGCAAGCAAGCCGTCGGCGCCAACGGTCAGGAGGGGTGGTATCTGCCTCCT
CGAGAAGATATCAACAGCCCGGACATGTACATTCCAGTCATGGCCCTCGTCACTTTCATTCTCCTCTCGACCCTC
ATTGCCGGCTTAAGAGGCAAGTTTCAGCCGGAGCTGCTGGGGTACACGGCGACGACGGGCATGGTGGTAGTCATT
GTCGAGATTGTCGCCCTCAAGCTGGGCTGCTTCATGTTGAGCATTTCGAGTCAGTCTCAGCTCCTCGATCTGATT
GCCTATTCCGGCTACAAATTTGTCGGCATCATCGTCACCATCGCCGTGGCCGAGATCTCCAACGGCGGAAAGGGC
ACTGGCGGTTGGGCTGGTTGGGCCGTCTTCTTCTATACCTTTTTGGCCAACTCTCTGTTCCTGATGCGATCCCTC
AAATATGTTTTGCTGCCGGAGACGTCCGGAAACACTGGCGGCCCTATGCAGACCGACTCCCGAGCGAAGCGCAAT
CAGAGGACGCAGTTTCTGTTTTTCTATTCATACATTGTTCAGTTTCTCTTCATGTGGGTTCTCACTAGAGCTTAA
Gene >Ophun1|204
ATGCAGCGGGCGCCTTACGGGCAGTCGCCCCCGTTGCACCACCCCGTGCCCCAGCACGTCTCGACGGTCCCCCAG
CTACGGTCACCACCTCCGCCGCCAGGCTCTGCGCAGTCACAACAGCAGAGCTATGGGGGAACGCCCTTCCAGCAG
CAGCAAGGCGCGGCGGGGGGCAACATGTTTGGCGGCTATGGCCAGTTCATGAACGATCCGGCTGCTCAGGTGGCT
GCCCAATTTGGCCAGACGGCTTTTAAGCATGGCCAGGAGTATGTCGAGCAGAATGTACCGGTGCCCTGTGTCCCG
TGTGATTGGCTTGGAAGCTGATAGTCACCGGCAGCTTGGTCGTTATGTCCAAATCTCGGCGCTCAAGCGCTACTT
CAACGTCTCCAACTCTTACGTCGTCAACAAGCTCTTCCTCGTCCTCTTTCCCTGGCGGCACAAGCCCTGGTCGCG
CAAGCAAGCCGTCGGCGCCAACGGTCAGGAGGGGTGGTATCTGCCTCCTCGAGAAGATATCAACAGCCCGGACAT
GTACATTCCAGGTTTGTTGTCTTTGCGGTTTGTTCGCGATCCCGCTGACAGGCTGACGTCTCAGTCATGGCCCTC
GTCACTTTCATTCTCCTCTCGACCCTCATTGCCGGCTTAAGAGGCAAGTTTCAGCCGGAGCTGCTGGGGTACACG
GCGACGACGGGCATGGTGGTAGTCATTGTCGAGATTGTCGCCCTCAAGCTGGGCTGCTTCATGTTGAGCATTTCG
AGTCAGTCTCAGCTCCTCGATCTGATTGCCTATTCCGGCTACAAATTTGTCGGCATCATCGTCACCATCGCCGTG
GCCGAGATCTCCAACGGCGGAAAGGGCACTGGCGGTTGGGCTGGTTGGGCCGTCTTCTTCTATACCTTTTTGGCC
AACTCTCTGTTCCTGGTAAGGTCATGAATGCTTGCCATTTTCAGTGACTGAAGCTTACCGGCTCCCTAGATGCGA
TCCCTCAAATATGTTTTGCTGCCGGAGACGTCCGGAAACACTGGCGGCCCTATGCAGACCGACTCCCGAGCGAAG
CGCAATCAGAGGACGCAGTTTCTGTTTTTCTATTCATACATTGTTCAGTTTCTCTTCATGTGGGTTCTCACTAGA
GCTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail