Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2038
Gene name
LocationContig_195:13287..14529
Strand-
Gene length (bp)1242
Transcript length (bp)1242
Coding sequence length (bp)1242
Protein length (aa) 414

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF18107 HTH_ABP1_N Fission yeast centromere protein N-terminal domain 5.8E-23 25 83
PF03221 HTH_Tnp_Tc5 Tc5 transposase DNA-binding domain 4.2E-17 98 160

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O14423|CBH1_SCHPO CENP-B homolog protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cbh1 PE=1 SV=2 26 158 4.0E-13
sp|O60108|CBH2_SCHPO CENP-B homolog protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cbh2 PE=3 SV=1 26 157 8.0E-13
sp|P49777|ABP1_SCHPO ARS-binding protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=abp1 PE=1 SV=2 25 160 1.0E-10

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1642
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|64
Ophiocordyceps australis map64 (Brazil) OphauB2|5931
Ophiocordyceps camponoti-floridani Ophcf2|03090
Ophiocordyceps camponoti-rufipedis Ophun1|2038 (this protein)
Ophiocordyceps kimflemingae Ophio5|1542
Ophiocordyceps subramaniannii Hirsu2|1329

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2038
MADVPIVTPEISPEIGQAVAVPAKERNSLTLDQRRNLRRWANSQPVRPSHKACIEWFLAQYGQQISQSTVSHSLS
PKYSRLDGDNPQLSGSRLRFGNWPDVEKLVLLWFQQVQASGRQPTNEELGEKAKSIFNQLPRYRDEQPPEFSPGW
IHRFKKRYGLLIRRQRRHADGDMNPADDIDYLADCVPRVMAVATDTSPAAIREQILRVVGVEASLNTCALVRDEV
LRRVSQHCPPPPAAHLAPPSDATSPSPSQPPPPPPPPPPPPANEQQQPQPQPQPQPQHQPQQHPPPPPSMYAEDD
PEVVLQNALRQLQQEEQAAEEQAAAVREERERHERVVDMQAAIMATPTARASSDPRYTTPAQDMAPELTLTPIHA
DGPVAHHDRPLRCPFCVNQRMLRTIKEAVEHMSTHVVV*
Coding >Ophun1|2038
ATGGCGGATGTCCCCATCGTCACTCCGGAGATCTCACCGGAGATCGGCCAGGCCGTCGCGGTCCCTGCCAAGGAG
CGGAATTCACTGACGCTCGATCAACGACGAAACCTTCGCCGTTGGGCCAACAGTCAGCCTGTTCGTCCCTCGCAC
AAGGCCTGTATCGAGTGGTTCCTCGCCCAGTATGGCCAGCAGATCAGCCAGTCGACCGTCTCGCACTCGCTATCG
CCCAAGTACTCGCGTCTCGATGGCGACAACCCGCAGCTCTCGGGCTCTCGCCTCCGTTTTGGAAACTGGCCCGAC
GTCGAGAAGCTGGTTCTGCTTTGGTTCCAGCAGGTTCAGGCCTCGGGTCGTCAGCCTACCAACGAGGAGCTAGGC
GAGAAGGCCAAGAGCATATTCAACCAGCTGCCTCGCTATCGCGACGAGCAACCGCCCGAGTTTTCGCCTGGCTGG
ATACACCGGTTCAAAAAACGATACGGCCTTCTGATCCGTCGTCAGCGTCGTCACGCAGACGGAGATATGAATCCA
GCTGATGACATCGACTACCTGGCCGACTGCGTGCCGCGAGTCATGGCTGTCGCAACCGACACGAGTCCTGCCGCC
ATTCGGGAGCAGATACTGCGCGTTGTCGGCGTCGAGGCGAGCCTCAACACGTGCGCCCTTGTCCGCGACGAGGTT
CTGCGTCGCGTCTCGCAGCACTGCCCTCCGCCGCCCGCCGCCCACCTTGCTCCGCCCTCAGACGCAACCTCTCCC
TCGCCATCACAGCCTCCTCCTCCTCCTCCTCCGCCTCCGCCGCCCCCGGCAAACGAGCAGCAGCAGCCGCAGCCG
CAGCCGCAGCCCCAGCCGCAACATCAACCACAACAGCACCCACCACCTCCGCCATCCATGTACGCCGAAGATGAC
CCCGAGGTGGTGCTGCAAAACGCCCTACGTCAGCTCCAGCAGGAGGAACAGGCAGCCGAGGAGCAGGCCGCCGCC
GTGCGCGAGGAGCGCGAGCGCCACGAGAGAGTCGTCGACATGCAGGCCGCCATCATGGCAACTCCGACCGCCCGC
GCCTCGTCCGACCCGAGATACACGACTCCTGCACAGGACATGGCCCCCGAGCTGACGCTGACACCCATCCACGCC
GACGGCCCTGTCGCCCATCACGACCGGCCCCTGCGCTGTCCCTTTTGCGTCAACCAGCGGATGCTGCGTACCATC
AAAGAAGCCGTCGAGCACATGTCAACTCACGTGGTTGTTTGA
Transcript >Ophun1|2038
ATGGCGGATGTCCCCATCGTCACTCCGGAGATCTCACCGGAGATCGGCCAGGCCGTCGCGGTCCCTGCCAAGGAG
CGGAATTCACTGACGCTCGATCAACGACGAAACCTTCGCCGTTGGGCCAACAGTCAGCCTGTTCGTCCCTCGCAC
AAGGCCTGTATCGAGTGGTTCCTCGCCCAGTATGGCCAGCAGATCAGCCAGTCGACCGTCTCGCACTCGCTATCG
CCCAAGTACTCGCGTCTCGATGGCGACAACCCGCAGCTCTCGGGCTCTCGCCTCCGTTTTGGAAACTGGCCCGAC
GTCGAGAAGCTGGTTCTGCTTTGGTTCCAGCAGGTTCAGGCCTCGGGTCGTCAGCCTACCAACGAGGAGCTAGGC
GAGAAGGCCAAGAGCATATTCAACCAGCTGCCTCGCTATCGCGACGAGCAACCGCCCGAGTTTTCGCCTGGCTGG
ATACACCGGTTCAAAAAACGATACGGCCTTCTGATCCGTCGTCAGCGTCGTCACGCAGACGGAGATATGAATCCA
GCTGATGACATCGACTACCTGGCCGACTGCGTGCCGCGAGTCATGGCTGTCGCAACCGACACGAGTCCTGCCGCC
ATTCGGGAGCAGATACTGCGCGTTGTCGGCGTCGAGGCGAGCCTCAACACGTGCGCCCTTGTCCGCGACGAGGTT
CTGCGTCGCGTCTCGCAGCACTGCCCTCCGCCGCCCGCCGCCCACCTTGCTCCGCCCTCAGACGCAACCTCTCCC
TCGCCATCACAGCCTCCTCCTCCTCCTCCTCCGCCTCCGCCGCCCCCGGCAAACGAGCAGCAGCAGCCGCAGCCG
CAGCCGCAGCCCCAGCCGCAACATCAACCACAACAGCACCCACCACCTCCGCCATCCATGTACGCCGAAGATGAC
CCCGAGGTGGTGCTGCAAAACGCCCTACGTCAGCTCCAGCAGGAGGAACAGGCAGCCGAGGAGCAGGCCGCCGCC
GTGCGCGAGGAGCGCGAGCGCCACGAGAGAGTCGTCGACATGCAGGCCGCCATCATGGCAACTCCGACCGCCCGC
GCCTCGTCCGACCCGAGATACACGACTCCTGCACAGGACATGGCCCCCGAGCTGACGCTGACACCCATCCACGCC
GACGGCCCTGTCGCCCATCACGACCGGCCCCTGCGCTGTCCCTTTTGCGTCAACCAGCGGATGCTGCGTACCATC
AAAGAAGCCGTCGAGCACATGTCAACTCACGTGGTTGTTTGA
Gene >Ophun1|2038
ATGGCGGATGTCCCCATCGTCACTCCGGAGATCTCACCGGAGATCGGCCAGGCCGTCGCGGTCCCTGCCAAGGAG
CGGAATTCACTGACGCTCGATCAACGACGAAACCTTCGCCGTTGGGCCAACAGTCAGCCTGTTCGTCCCTCGCAC
AAGGCCTGTATCGAGTGGTTCCTCGCCCAGTATGGCCAGCAGATCAGCCAGTCGACCGTCTCGCACTCGCTATCG
CCCAAGTACTCGCGTCTCGATGGCGACAACCCGCAGCTCTCGGGCTCTCGCCTCCGTTTTGGAAACTGGCCCGAC
GTCGAGAAGCTGGTTCTGCTTTGGTTCCAGCAGGTTCAGGCCTCGGGTCGTCAGCCTACCAACGAGGAGCTAGGC
GAGAAGGCCAAGAGCATATTCAACCAGCTGCCTCGCTATCGCGACGAGCAACCGCCCGAGTTTTCGCCTGGCTGG
ATACACCGGTTCAAAAAACGATACGGCCTTCTGATCCGTCGTCAGCGTCGTCACGCAGACGGAGATATGAATCCA
GCTGATGACATCGACTACCTGGCCGACTGCGTGCCGCGAGTCATGGCTGTCGCAACCGACACGAGTCCTGCCGCC
ATTCGGGAGCAGATACTGCGCGTTGTCGGCGTCGAGGCGAGCCTCAACACGTGCGCCCTTGTCCGCGACGAGGTT
CTGCGTCGCGTCTCGCAGCACTGCCCTCCGCCGCCCGCCGCCCACCTTGCTCCGCCCTCAGACGCAACCTCTCCC
TCGCCATCACAGCCTCCTCCTCCTCCTCCTCCGCCTCCGCCGCCCCCGGCAAACGAGCAGCAGCAGCCGCAGCCG
CAGCCGCAGCCCCAGCCGCAACATCAACCACAACAGCACCCACCACCTCCGCCATCCATGTACGCCGAAGATGAC
CCCGAGGTGGTGCTGCAAAACGCCCTACGTCAGCTCCAGCAGGAGGAACAGGCAGCCGAGGAGCAGGCCGCCGCC
GTGCGCGAGGAGCGCGAGCGCCACGAGAGAGTCGTCGACATGCAGGCCGCCATCATGGCAACTCCGACCGCCCGC
GCCTCGTCCGACCCGAGATACACGACTCCTGCACAGGACATGGCCCCCGAGCTGACGCTGACACCCATCCACGCC
GACGGCCCTGTCGCCCATCACGACCGGCCCCTGCGCTGTCCCTTTTGCGTCAACCAGCGGATGCTGCGTACCATC
AAAGAAGCCGTCGAGCACATGTCAACTCACGTGGTTGTTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail