Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2031
Gene name
LocationContig_1940:257..1023
Strand+
Gene length (bp)766
Transcript length (bp)720
Coding sequence length (bp)720
Protein length (aa) 240

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01168 Ala_racemase_N Alanine racemase, N-terminal domain 9.8E-12 13 188

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9US35|DSD1_SCHPO D-serine dehydratase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1039.06 PE=3 SV=1 3 184 3.0E-25
sp|P53095|DSD1_YEAST D-serine dehydratase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DSD1 PE=1 SV=2 13 217 4.0E-16

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2031
MRLQVGPSGPVRIVVSTLAEAEFLLPALLDLGRSDRPVNILYGLPLPRSAIPRLSALSHALGPRSISVLVDDPAQ
VPLIQTLASQAVDAPLVFIKIDMGGRRAGVTVEGERMAELVAALRAAKGIVLAGLYSHAGHSYAGRSRGDALRML
GEEIGALGRGAERVREGFGDELGLVLSVGASPTALAARGLADDVNDADDDDDDMAAEKSTLTKLASTPSSTSNNS
PPEASTRPASPGPT*
Coding >Ophun1|2031
ATGCGCCTCCAGGTCGGACCCTCCGGCCCCGTCCGTATCGTCGTCTCCACCCTCGCCGAAGCCGAGTTCCTCCTC
CCGGCCCTCCTCGACCTCGGCCGCTCCGACCGGCCGGTGAATATCCTCTACGGCCTCCCGCTCCCCCGCTCGGCA
ATCCCCCGTCTGTCCGCCCTCTCACACGCCCTCGGCCCTCGCTCCATCTCCGTCCTCGTCGACGACCCAGCCCAA
GTGCCCCTCATCCAGACCCTCGCCTCCCAAGCCGTCGACGCACCCCTCGTCTTCATCAAGATCGACATGGGAGGA
CGGAGAGCGGGCGTGACGGTCGAGGGGGAGCGCATGGCTGAGCTGGTTGCTGCGCTGAGGGCTGCCAAGGGGATC
GTGCTGGCGGGCTTGTACTCGCATGCTGGGCATTCGTATGCGGGGAGGTCGAGGGGGGATGCGCTGAGGATGCTG
GGTGAGGAGATTGGGGCGTTGGGCAGGGGGGCGGAGAGGGTTAGGGAGGGGTTTGGTGATGAGTTGGGGCTTGTG
CTTTCTGTTGGGGCTTCGCCTACGGCTTTGGCGGCGAGGGGGTTGGCGGATGACGTCAATGACGCCGATGACGAT
GACGATGACATGGCAGCCGAAAAGTCGACACTTACAAAACTCGCGTCTACCCCCTCCTCGACCTCCAACAACTCT
CCGCCCGAAGCATCCACCCGTCCAGCCTCTCCTGGCCCGACCTAG
Transcript >Ophun1|2031
ATGCGCCTCCAGGTCGGACCCTCCGGCCCCGTCCGTATCGTCGTCTCCACCCTCGCCGAAGCCGAGTTCCTCCTC
CCGGCCCTCCTCGACCTCGGCCGCTCCGACCGGCCGGTGAATATCCTCTACGGCCTCCCGCTCCCCCGCTCGGCA
ATCCCCCGTCTGTCCGCCCTCTCACACGCCCTCGGCCCTCGCTCCATCTCCGTCCTCGTCGACGACCCAGCCCAA
GTGCCCCTCATCCAGACCCTCGCCTCCCAAGCCGTCGACGCACCCCTCGTCTTCATCAAGATCGACATGGGAGGA
CGGAGAGCGGGCGTGACGGTCGAGGGGGAGCGCATGGCTGAGCTGGTTGCTGCGCTGAGGGCTGCCAAGGGGATC
GTGCTGGCGGGCTTGTACTCGCATGCTGGGCATTCGTATGCGGGGAGGTCGAGGGGGGATGCGCTGAGGATGCTG
GGTGAGGAGATTGGGGCGTTGGGCAGGGGGGCGGAGAGGGTTAGGGAGGGGTTTGGTGATGAGTTGGGGCTTGTG
CTTTCTGTTGGGGCTTCGCCTACGGCTTTGGCGGCGAGGGGGTTGGCGGATGACGTCAATGACGCCGATGACGAT
GACGATGACATGGCAGCCGAAAAGTCGACACTTACAAAACTCGCGTCTACCCCCTCCTCGACCTCCAACAACTCT
CCGCCCGAAGCATCCACCCGTCCAGCCTCTCCTGGCCCGACCTAG
Gene >Ophun1|2031
ATGCGCCTCCAGGTCGGACCCTCCGGCCCCGTCCGTATCGTCGTCTCCACCCTCGCCGAAGCCGAGTTCCTCCTC
CCGGCCCTCCTCGACCTCGGCCGCTCCGACCGGCCGGTGAATATCCTCTACGGCCTCCCGCTCCCCCGCTCGGCA
ATCCCCCGTCTGTCCGCCCTCTCACACGCCCTCGGCCCTCGCTCCATCTCCGTCCTCGTCGACGACCCAGCCCAA
GTGCCCCTCATCCAGACCCTCGCCTCCCAAGCCGTCGACGCACCCCTCGTCTTCATCAAGATCGACATGGGAGGA
CGGAGAGCGGGCGTGACGGTCGAGGGGGAGCGCATGGCTGAGCTGGTTGCTGCGCTGAGGGCTGCCAAGGGGATC
GTGCTGGCGGGCTTGTACTCGCATGCTGGGCATTCGTATGCGGGGAGGTCGAGGGGGGATGCGCTGAGGATGCTG
GGTGAGGAGATTGGGGCGTTGGGCAGGGGGGCGGAGAGGGTTAGGGAGGGGTTTGGTGATGAGTTGGGGCTTGTG
CTTTCTGTTGGGGCTTCGCCTACGGCTTTGGCGGCGAGGGGGTTGGCGGATGACGTCAATGACGCCGATGACGAT
GACGATGACATGGCAGCCGAAAAGTCGACACTTACAAAACTCGTCTCCTCGATGAAAACGCGGAACCTCAGTATA
GAACTCCACGCAGGCGTCTACCCCCTCCTCGACCTCCAACAACTCTCCGCCCGAAGCATCCACCCGTCCAGCCTC
TCCTGGCCCGACCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail