Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2029
Gene name
LocationContig_194:24088..26725
Strand-
Gene length (bp)2637
Transcript length (bp)2409
Coding sequence length (bp)2409
Protein length (aa) 803

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09088 MIF4G_like MIF4G like 2.3E-84 328 518
PF09090 MIF4G_like_2 MIF4G like 1.5E-56 535 776

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O14253|NCBP1_SCHPO Nuclear cap-binding protein subunit 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cbc1 PE=1 SV=1 16 779 5.0E-81
sp|Q754H6|NCBP1_ASHGO Nuclear cap-binding protein complex subunit 1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CBC1 PE=3 SV=2 16 668 2.0E-49
sp|P34160|NCBP1_YEAST Nuclear cap-binding protein complex subunit 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STO1 PE=1 SV=2 15 648 8.0E-45
sp|Q29G82|NCBP1_DROPS Nuclear cap-binding protein subunit 1 OS=Drosophila pseudoobscura pseudoobscura GN=Cbp80 PE=3 SV=1 15 703 5.0E-44
sp|B4GW22|NCBP1_DROPE Nuclear cap-binding protein subunit 1 OS=Drosophila persimilis GN=Cbp80 PE=3 SV=1 15 703 5.0E-44
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O14253|NCBP1_SCHPO Nuclear cap-binding protein subunit 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cbc1 PE=1 SV=1 16 779 5.0E-81
sp|Q754H6|NCBP1_ASHGO Nuclear cap-binding protein complex subunit 1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CBC1 PE=3 SV=2 16 668 2.0E-49
sp|P34160|NCBP1_YEAST Nuclear cap-binding protein complex subunit 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STO1 PE=1 SV=2 15 648 8.0E-45
sp|Q29G82|NCBP1_DROPS Nuclear cap-binding protein subunit 1 OS=Drosophila pseudoobscura pseudoobscura GN=Cbp80 PE=3 SV=1 15 703 5.0E-44
sp|B4GW22|NCBP1_DROPE Nuclear cap-binding protein subunit 1 OS=Drosophila persimilis GN=Cbp80 PE=3 SV=1 15 703 5.0E-44
sp|B3NU52|NCBP1_DROER Nuclear cap-binding protein subunit 1 OS=Drosophila erecta GN=Cbp80 PE=3 SV=1 15 703 1.0E-43
sp|B4NC41|NCBP1_DROWI Nuclear cap-binding protein subunit 1 OS=Drosophila willistoni GN=Cbp80 PE=3 SV=1 15 717 9.0E-43
sp|Q7PX35|NCBP1_ANOGA Nuclear cap-binding protein subunit 1 OS=Anopheles gambiae GN=Cbp80 PE=3 SV=4 15 706 3.0E-42
sp|B4Q034|NCBP1_DROYA Nuclear cap-binding protein subunit 1 OS=Drosophila yakuba GN=Cbp80 PE=3 SV=1 15 703 3.0E-42
sp|Q16UN6|NCBP1_AEDAE Nuclear cap-binding protein subunit 1 OS=Aedes aegypti GN=Cbp80 PE=3 SV=1 15 717 4.0E-42
sp|B4I0W6|NCBP1_DROSE Nuclear cap-binding protein subunit 1 OS=Drosophila sechellia GN=Cbp80 PE=3 SV=1 15 703 5.0E-42
sp|Q7K4N3|NCBP1_DROME Nuclear cap-binding protein subunit 1 OS=Drosophila melanogaster GN=Cbp80 PE=1 SV=1 15 703 6.0E-42
sp|B3MS75|NCBP1_DROAN Nuclear cap-binding protein subunit 1 OS=Drosophila ananassae GN=Cbp80 PE=3 SV=1 15 703 2.0E-41
sp|B4JM29|NCBP1_DROGR Nuclear cap-binding protein subunit 1 OS=Drosophila grimshawi GN=Cbp80 PE=3 SV=1 15 703 1.0E-40
sp|B4L2J8|NCBP1_DROMO Nuclear cap-binding protein subunit 1 OS=Drosophila mojavensis GN=Cbp80 PE=3 SV=1 15 723 1.0E-40
sp|Q9SIU2|NCBP1_ARATH Nuclear cap-binding protein subunit 1 OS=Arabidopsis thaliana GN=ABH1 PE=1 SV=2 89 762 2.0E-40
sp|Q10LJ0|NCBP1_ORYSJ Nuclear cap-binding protein subunit 1 OS=Oryza sativa subsp. japonica GN=ABH1 PE=2 SV=1 89 703 9.0E-38
sp|C0H906|NCBP1_SALSA Nuclear cap-binding protein subunit 1 OS=Salmo salar GN=ncbp1 PE=2 SV=1 17 706 6.0E-36
sp|Q6GQD0|NBP1B_XENLA Nuclear cap-binding protein subunit 1-B OS=Xenopus laevis GN=ncbp1-b PE=2 SV=1 17 791 2.0E-35
sp|Q6DIE2|NCBP1_XENTR Nuclear cap-binding protein subunit 1 OS=Xenopus tropicalis GN=ncbp1 PE=2 SV=1 17 791 3.0E-35
sp|B4M7T6|NCBP1_DROVI Nuclear cap-binding protein subunit 1 OS=Drosophila virilis GN=Cbp80 PE=3 SV=1 15 711 2.0E-34
sp|Q6GQ80|NBP1A_XENLA Nuclear cap-binding protein subunit 1-A OS=Xenopus laevis GN=ncbp1-a PE=2 SV=1 17 722 5.0E-34
sp|Q5ZJZ6|NCBP1_CHICK Nuclear cap-binding protein subunit 1 OS=Gallus gallus GN=NCBP1 PE=2 SV=1 252 706 2.0E-33
sp|Q09161|NCBP1_HUMAN Nuclear cap-binding protein subunit 1 OS=Homo sapiens GN=NCBP1 PE=1 SV=1 17 706 1.0E-31
sp|Q55D17|NCBP1_DICDI Nuclear cap-binding protein subunit 1 OS=Dictyostelium discoideum GN=ncbp1 PE=3 SV=1 89 668 4.0E-31
sp|Q56A27|NCBP1_RAT Nuclear cap-binding protein subunit 1 OS=Rattus norvegicus GN=Ncbp1 PE=1 SV=1 255 706 2.0E-30
sp|Q3UYV9|NCBP1_MOUSE Nuclear cap-binding protein subunit 1 OS=Mus musculus GN=Ncbp1 PE=1 SV=2 255 706 3.0E-30
sp|A8XG63|NCBP1_CAEBR Nuclear cap-binding protein subunit 1 OS=Caenorhabditis briggsae GN=ncbp-1 PE=3 SV=3 17 666 8.0E-22
sp|O01763|NCBP1_CAEEL Nuclear cap-binding protein subunit 1 OS=Caenorhabditis elegans GN=ncbp-1 PE=3 SV=3 252 666 1.0E-19
[Show less]

GO

GO Term Description Terminal node
GO:0016070 RNA metabolic process Yes
GO:0006807 nitrogen compound metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0008152 metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0009987 cellular process No
GO:0071704 organic substance metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0008150 biological_process No
GO:0044238 primary metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0044237 cellular metabolic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1764
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6825
Ophiocordyceps australis map64 (Brazil) OphauB2|3650
Ophiocordyceps camponoti-floridani Ophcf2|00642
Ophiocordyceps camponoti-rufipedis Ophun1|2029 (this protein)
Ophiocordyceps kimflemingae Ophio5|3636
Ophiocordyceps subramaniannii Hirsu2|1671

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2029
MADSDRRQAAAGHNNRKRRQRDDDDSYDRRQQRRRTDSLPVPVRLRRQLLALADSPLRQWGAEVQAVARLLHENA
EDEQLSRNFVNLSMQLVAEQPLKTPFVAAVVLVVNTLKSDVVEALLARLARDIDGSLGSGEWRRAKLLLKFLACL
QPCLKGDGVFPLLEELFGRAADLQTASSDDTIGTEIVKIILLTIPYVMASAPGKFQQKAADLMEKTDIIASEPHA
LQALVDPFHPEGNDASPTASNNLCMLLQKQLQAEAANNWELACLPRPWQFALEDIEMQEKLSEAPKHELPAINVP
QAVVAGPRPLFPEVYLSVYADQEIESVPGPSNIAASLIRDGLVDTLNVLDFNRNAVARYLMDLDCYFAEGTFVKR
ATPFDELRNFPDGRATWKPEDVAVDTVFSQLFLLPNPECKVVYYHSVLTEACKLAPAAIAPSLGRAIRYLYRNSP
RMDLELSHRFLDWFSHHLSNFGFTWKWAEWAEDAQLSDLHPRKWFLVGAMDKEVRLSFAQRIRKTLPEAYQPLVG
EDKDKDVPDFKFSDDATPFSAEGQEMGALLKRKGSDDEMQAVMDRVQALASEQGVDPVVANADVFMTTICWVGSK
SLSHVLACIDRTKGRLVEVGAASPAARAQIITAVMTYWAAHPGVALSILEKLLNYSIISPVSIVDWALVASSPCG
GSEGGHSLAKPHVLELVRNTVAKVSGRIREVLTSADADAQTREKESQSMRDLLGAINAALAVWAAGESDADVMDD
GEGGAMIRRWASRWMRVFGRMAAIEEAFMVEAGKGGGAVTTTTMEDGDGEIL*
Coding >Ophun1|2029
ATGGCGGACTCGGATAGACGACAGGCGGCGGCGGGTCACAATAATCGCAAGCGAAGGCAGCGCGATGACGATGAC
TCCTACGACCGCCGACAGCAGCGGCGTCGAACCGACTCTTTGCCGGTGCCCGTTCGCCTCCGTCGTCAGCTCCTC
GCTCTGGCCGACTCTCCGCTGCGGCAGTGGGGAGCTGAGGTTCAGGCGGTGGCGCGCCTGCTCCACGAAAACGCC
GAGGACGAGCAGCTGAGCAGAAACTTCGTCAACCTGTCGATGCAGCTTGTGGCGGAGCAGCCGCTCAAGACGCCC
TTTGTGGCTGCCGTTGTGCTGGTGGTCAACACGCTCAAATCAGATGTTGTCGAGGCGCTGCTCGCTCGCCTGGCG
CGTGACATCGATGGCAGCCTGGGGTCGGGCGAGTGGCGGCGGGCGAAGCTGCTGCTCAAGTTCCTCGCCTGTCTG
CAGCCTTGCTTGAAGGGAGATGGCGTCTTTCCGCTCTTGGAGGAGCTCTTCGGTCGTGCTGCCGATTTGCAGACG
GCCAGTTCTGACGATACGATCGGAACGGAAATTGTCAAAATCATCCTCCTCACGATCCCCTACGTCATGGCCTCT
GCGCCGGGAAAGTTCCAGCAAAAGGCGGCGGATCTGATGGAGAAGACGGACATCATCGCCTCCGAGCCTCACGCC
CTTCAGGCCTTGGTGGATCCTTTCCATCCGGAGGGCAATGACGCGAGCCCGACGGCCTCGAACAACCTTTGCATG
CTGCTGCAGAAGCAGCTTCAAGCCGAGGCGGCCAACAACTGGGAGCTCGCCTGCCTGCCTCGCCCCTGGCAGTTT
GCTCTCGAGGATATTGAGATGCAGGAGAAGCTCAGCGAGGCTCCCAAGCACGAACTGCCCGCCATCAACGTTCCG
CAGGCCGTCGTTGCTGGGCCGCGGCCGCTGTTCCCCGAGGTCTACCTCTCCGTCTACGCGGACCAGGAGATCGAG
TCCGTTCCCGGACCGTCTAACATTGCGGCGTCGCTGATCCGTGACGGCCTCGTCGACACGCTCAACGTGCTCGAC
TTTAACCGAAACGCCGTGGCTCGATATCTCATGGACCTCGATTGCTACTTCGCCGAAGGCACCTTTGTCAAGCGG
GCAACGCCCTTCGACGAGCTGCGTAACTTTCCCGATGGCCGGGCCACGTGGAAGCCCGAAGACGTGGCTGTCGAT
ACCGTCTTCTCTCAGCTCTTCCTGCTGCCCAATCCCGAGTGCAAGGTCGTCTACTATCACTCGGTGCTCACCGAG
GCCTGCAAGCTCGCGCCGGCAGCCATCGCGCCCAGCCTCGGGAGGGCCATCCGATATCTCTACCGCAACAGTCCC
CGCATGGATCTCGAGCTCAGCCACCGCTTCCTCGACTGGTTCTCGCACCACCTCAGCAACTTTGGCTTCACCTGG
AAGTGGGCCGAGTGGGCCGAAGATGCCCAGCTGTCTGACCTCCATCCGCGCAAGTGGTTCCTCGTGGGCGCCATG
GACAAAGAGGTGAGGCTCAGCTTCGCGCAGAGGATCCGGAAGACGCTTCCCGAAGCCTACCAGCCCCTGGTCGGG
GAGGACAAGGACAAGGACGTGCCGGACTTTAAGTTTAGCGATGACGCAACCCCCTTCTCGGCCGAGGGCCAAGAG
ATGGGCGCGCTCCTCAAGCGAAAGGGTTCCGACGACGAGATGCAGGCCGTCATGGATAGAGTCCAGGCCCTCGCC
AGCGAGCAGGGCGTCGATCCCGTCGTGGCCAACGCCGACGTCTTCATGACGACCATCTGCTGGGTGGGATCCAAA
TCGCTCAGCCACGTACTGGCCTGCATCGACCGCACCAAGGGACGACTCGTCGAAGTCGGCGCCGCCTCTCCCGCA
GCCCGAGCGCAGATCATCACCGCCGTCATGACCTACTGGGCCGCACACCCGGGCGTGGCCCTCTCCATCCTGGAG
AAGCTCCTCAACTACTCCATCATCAGCCCCGTCTCCATCGTCGACTGGGCCCTGGTAGCTTCATCCCCTTGCGGC
GGCTCAGAAGGAGGCCACTCGCTCGCAAAGCCGCACGTCCTGGAGCTGGTGCGCAACACCGTCGCCAAAGTCAGC
GGCCGCATCCGCGAAGTCCTCACCTCGGCCGACGCCGACGCCCAAACGCGCGAGAAGGAATCGCAGTCGATGCGC
GACCTCCTGGGCGCCATCAACGCCGCGCTCGCCGTCTGGGCCGCAGGGGAAAGCGACGCAGACGTCATGGACGAC
GGCGAGGGCGGCGCCATGATTCGCCGCTGGGCGAGTCGCTGGATGAGGGTTTTTGGCCGCATGGCTGCCATTGAG
GAGGCGTTTATGGTCGAGGCTGGGAAGGGGGGTGGAGCGGTGACGACGACGACGATGGAGGATGGCGACGGTGAG
ATTCTTTAG
Transcript >Ophun1|2029
ATGGCGGACTCGGATAGACGACAGGCGGCGGCGGGTCACAATAATCGCAAGCGAAGGCAGCGCGATGACGATGAC
TCCTACGACCGCCGACAGCAGCGGCGTCGAACCGACTCTTTGCCGGTGCCCGTTCGCCTCCGTCGTCAGCTCCTC
GCTCTGGCCGACTCTCCGCTGCGGCAGTGGGGAGCTGAGGTTCAGGCGGTGGCGCGCCTGCTCCACGAAAACGCC
GAGGACGAGCAGCTGAGCAGAAACTTCGTCAACCTGTCGATGCAGCTTGTGGCGGAGCAGCCGCTCAAGACGCCC
TTTGTGGCTGCCGTTGTGCTGGTGGTCAACACGCTCAAATCAGATGTTGTCGAGGCGCTGCTCGCTCGCCTGGCG
CGTGACATCGATGGCAGCCTGGGGTCGGGCGAGTGGCGGCGGGCGAAGCTGCTGCTCAAGTTCCTCGCCTGTCTG
CAGCCTTGCTTGAAGGGAGATGGCGTCTTTCCGCTCTTGGAGGAGCTCTTCGGTCGTGCTGCCGATTTGCAGACG
GCCAGTTCTGACGATACGATCGGAACGGAAATTGTCAAAATCATCCTCCTCACGATCCCCTACGTCATGGCCTCT
GCGCCGGGAAAGTTCCAGCAAAAGGCGGCGGATCTGATGGAGAAGACGGACATCATCGCCTCCGAGCCTCACGCC
CTTCAGGCCTTGGTGGATCCTTTCCATCCGGAGGGCAATGACGCGAGCCCGACGGCCTCGAACAACCTTTGCATG
CTGCTGCAGAAGCAGCTTCAAGCCGAGGCGGCCAACAACTGGGAGCTCGCCTGCCTGCCTCGCCCCTGGCAGTTT
GCTCTCGAGGATATTGAGATGCAGGAGAAGCTCAGCGAGGCTCCCAAGCACGAACTGCCCGCCATCAACGTTCCG
CAGGCCGTCGTTGCTGGGCCGCGGCCGCTGTTCCCCGAGGTCTACCTCTCCGTCTACGCGGACCAGGAGATCGAG
TCCGTTCCCGGACCGTCTAACATTGCGGCGTCGCTGATCCGTGACGGCCTCGTCGACACGCTCAACGTGCTCGAC
TTTAACCGAAACGCCGTGGCTCGATATCTCATGGACCTCGATTGCTACTTCGCCGAAGGCACCTTTGTCAAGCGG
GCAACGCCCTTCGACGAGCTGCGTAACTTTCCCGATGGCCGGGCCACGTGGAAGCCCGAAGACGTGGCTGTCGAT
ACCGTCTTCTCTCAGCTCTTCCTGCTGCCCAATCCCGAGTGCAAGGTCGTCTACTATCACTCGGTGCTCACCGAG
GCCTGCAAGCTCGCGCCGGCAGCCATCGCGCCCAGCCTCGGGAGGGCCATCCGATATCTCTACCGCAACAGTCCC
CGCATGGATCTCGAGCTCAGCCACCGCTTCCTCGACTGGTTCTCGCACCACCTCAGCAACTTTGGCTTCACCTGG
AAGTGGGCCGAGTGGGCCGAAGATGCCCAGCTGTCTGACCTCCATCCGCGCAAGTGGTTCCTCGTGGGCGCCATG
GACAAAGAGGTGAGGCTCAGCTTCGCGCAGAGGATCCGGAAGACGCTTCCCGAAGCCTACCAGCCCCTGGTCGGG
GAGGACAAGGACAAGGACGTGCCGGACTTTAAGTTTAGCGATGACGCAACCCCCTTCTCGGCCGAGGGCCAAGAG
ATGGGCGCGCTCCTCAAGCGAAAGGGTTCCGACGACGAGATGCAGGCCGTCATGGATAGAGTCCAGGCCCTCGCC
AGCGAGCAGGGCGTCGATCCCGTCGTGGCCAACGCCGACGTCTTCATGACGACCATCTGCTGGGTGGGATCCAAA
TCGCTCAGCCACGTACTGGCCTGCATCGACCGCACCAAGGGACGACTCGTCGAAGTCGGCGCCGCCTCTCCCGCA
GCCCGAGCGCAGATCATCACCGCCGTCATGACCTACTGGGCCGCACACCCGGGCGTGGCCCTCTCCATCCTGGAG
AAGCTCCTCAACTACTCCATCATCAGCCCCGTCTCCATCGTCGACTGGGCCCTGGTAGCTTCATCCCCTTGCGGC
GGCTCAGAAGGAGGCCACTCGCTCGCAAAGCCGCACGTCCTGGAGCTGGTGCGCAACACCGTCGCCAAAGTCAGC
GGCCGCATCCGCGAAGTCCTCACCTCGGCCGACGCCGACGCCCAAACGCGCGAGAAGGAATCGCAGTCGATGCGC
GACCTCCTGGGCGCCATCAACGCCGCGCTCGCCGTCTGGGCCGCAGGGGAAAGCGACGCAGACGTCATGGACGAC
GGCGAGGGCGGCGCCATGATTCGCCGCTGGGCGAGTCGCTGGATGAGGGTTTTTGGCCGCATGGCTGCCATTGAG
GAGGCGTTTATGGTCGAGGCTGGGAAGGGGGGTGGAGCGGTGACGACGACGACGATGGAGGATGGCGACGGTGAG
ATTCTTTAG
Gene >Ophun1|2029
ATGGCGGACTCGGATAGACGACAGGCGGCGGCGGGTCACAATAATCGCAAGCGAAGGCAGCGCGGTAAGCATGAC
GTTGCGGGCAGCATGACGATGCGGGCAGCCGAGGGAGAAGAAGGAAGCTGACGGACGGGATGGAGCCGCAGATGA
CGATGACTCCTACGACCGCCGACAGCAGCGGCGTCGAACCGACTCTTTGCCGGTGCCCGTTCGCCTCCGTCGTCA
GCTCCTCGCTCTGGCCGACTCTCCGCTGCGGCAGTGGGGAGCTGAGGTTCAGGCGGTGGCGCGCCTGCTCCACGA
AAACGCCGAGGACGAGCAGCTGAGCAGAAACTTCGTCAACCTGTCGATGCAGCTTGTGGCGGAGCAGCCGCTCAA
GACGCCCTTTGTGGCTGCCGTTGTGCTGGTGGTCAACACGCTCAAATCAGATGTTGTCGAGGCGCTGCTCGCTCG
CCTGGCGCGTGACATCGATGGCAGCCTGGGGTCGGGCGAGTGGCGGCGGGCGAAGCTGCTGCTCAAGTTCCTCGC
CTGTCTGCAGCCTTGCTTGAAGGGAGATGGCGTCTTTCCGCTCTTGGAGGAGCTCTTCGGTCGTGCTGCCGATTT
GCAGACGGCCAGTTCTGACGATGTAGGGCCTTGGCTTTTTTTTTTTTTCTTGTTTTTGTCATTTGCCCTACGTCC
TCTCCCTATCGCGTGCTGAAGCTGATGCGTCGGATTGGAGACGATCGGAACGGAAATTGTCAAAATCATCCTCCT
CACGATCCCCTACGTCATGGCCTCTGCGCCGGGAAAGTTCCAGCAAAAGGCGGCGGATCTGATGGAGAAGACGGA
CATCATCGCCTCCGAGCCTCACGCCCTTCAGGCCTTGGTGGATCCTTTCCATCCGGAGGGCAATGACGCGAGCCC
GACGGCCTCGAACAACCTTTGCATGCTGCTGCAGAAGCAGCTTCAAGCCGAGGCGGCCAACAACTGGGAGCTCGC
CTGCCTGCCTCGCCCCTGGCAGTTTGCTCTCGAGGATATTGAGATGCAGGAGAAGCTCAGCGAGGCTCCCAAGCA
CGAACTGCCCGCCATCAACGTTCCGCAGGCCGTCGTTGCTGGGCCGCGGCCGCTGTTCCCCGAGGTCTACCTCTC
CGTCTACGCGGACCAGGAGATCGAGTCCGTTCCCGGACCGTCTAACATTGCGGCGTCGCTGATCCGTGACGGCCT
CGTCGACACGCTCAACGTGCTCGACTTTAACCGAAACGCCGTGGCTCGATATCTCATGGACCTCGATTGCTACTT
CGCCGAAGGCACCTTTGTCAAGCGGGCAACGCCCTTCGACGAGCTGCGTAACTTTCCCGATGGCCGGGCCACGTG
GAAGCCCGAAGACGTGGCTGTCGATACCGTCTTCTCTCAGCTCTTCCTGCTGCCCAATCCCGAGTGCAAGGTCGT
CTACTATCACTCGGTGCTCACCGAGGCCTGCAAGCTCGCGCCGGCAGCCATCGCGCCCAGCCTCGGGAGGGCCAT
CCGATATCTCTACCGCAACAGTCCCCGCATGGATCTCGAGCTCAGCCACCGCTTCCTCGACTGGTTCTCGCACCA
CCTCAGCAACTTTGGCTTCACCTGGAAGTGGGCCGAGTGGGCCGAAGATGCCCAGCTGTCTGACCTCCATCCGCG
CAAGTGGTTCCTCGTGGGCGCCATGGACAAAGAGGTGAGGCTCAGCTTCGCGCAGAGGATCCGGAAGACGCTTCC
CGAAGCCTACCAGCCCCTGGTCGGGGAGGACAAGGACAAGGACGTGCCGGACTTTAAGTTTAGCGATGACGGTAG
GATCCGTGTCGTCTCCCATGCGCACGTCGACATGCTAAACCCTTCATAGCAACCCCCTTCTCGGCCGAGGGCCAA
GAGATGGGCGCGCTCCTCAAGCGAAAGGGTTCCGACGACGAGATGCAGGCCGTCATGGATAGAGTCCAGGCCCTC
GCCAGCGAGCAGGGCGTCGATCCCGTCGTGGCCAACGCCGACGTCTTCATGACGACCATCTGCTGGGTGGGATCC
AAATCGCTCAGCCACGTACTGGCCTGCATCGACCGCACCAAGGGACGACTCGTCGAAGTCGGCGCCGCCTCTCCC
GCAGCCCGAGCGCAGATCATCACCGCCGTCATGACCTACTGGGCCGCACACCCGGGCGTGGCCCTCTCCATCCTG
GAGAAGCTCCTCAACTACTCCATCATCAGCCCCGTCTCCATCGTCGACTGGGCCCTGGTAGCTTCATCCCCTTGC
GGCGGCTCAGAAGGAGGCCACTCGCTCGCAAAGCCGCACGTCCTGGAGCTGGTGCGCAACACCGTCGCCAAAGTC
AGCGGCCGCATCCGCGAAGTCCTCACCTCGGCCGACGCCGACGCCCAAACGCGCGAGAAGGAATCGCAGTCGATG
CGCGACCTCCTGGGCGCCATCAACGCCGCGCTCGCCGTCTGGGCCGCAGGGGAAAGCGACGCAGACGTCATGGAC
GACGGCGAGGGCGGCGCCATGATTCGCCGCTGGGCGAGTCGCTGGATGAGGGTTTTTGGCCGCATGGCTGCCATT
GAGGAGGCGTTTATGGTCGAGGCTGGGAAGGGGGGTGGAGCGGTGACGACGACGACGATGGAGGATGGCGACGGT
GAGATTCTTTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail