Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2028
Gene name
LocationContig_194:21619..23466
Strand+
Gene length (bp)1847
Transcript length (bp)1794
Coding sequence length (bp)1794
Protein length (aa) 598

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07662 Nucleos_tra2_C Na+ dependent nucleoside transporter C-terminus 6.6E-71 368 580
PF01773 Nucleos_tra2_N Na+ dependent nucleoside transporter N-terminus 2.6E-22 183 253

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UA35|S28A3_EPTST Solute carrier family 28 member 3 OS=Eptatretus stoutii GN=SLC28A3 PE=2 SV=1 176 587 5.0E-79
sp|Q9ERH8|S28A3_MOUSE Solute carrier family 28 member 3 OS=Mus musculus GN=Slc28a3 PE=2 SV=1 180 588 7.0E-77
sp|Q8VIH3|S28A3_RAT Solute carrier family 28 member 3 OS=Rattus norvegicus GN=Slc28a3 PE=2 SV=1 177 587 7.0E-77
sp|O32115|YUTK_BACSU Uncharacterized transporter YutK OS=Bacillus subtilis (strain 168) GN=yutK PE=3 SV=1 182 583 1.0E-74
sp|Q62773|S28A2_RAT Sodium/nucleoside cotransporter 2 OS=Rattus norvegicus GN=Slc28a2 PE=1 SV=1 175 582 6.0E-74
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UA35|S28A3_EPTST Solute carrier family 28 member 3 OS=Eptatretus stoutii GN=SLC28A3 PE=2 SV=1 176 587 5.0E-79
sp|Q9ERH8|S28A3_MOUSE Solute carrier family 28 member 3 OS=Mus musculus GN=Slc28a3 PE=2 SV=1 180 588 7.0E-77
sp|Q8VIH3|S28A3_RAT Solute carrier family 28 member 3 OS=Rattus norvegicus GN=Slc28a3 PE=2 SV=1 177 587 7.0E-77
sp|O32115|YUTK_BACSU Uncharacterized transporter YutK OS=Bacillus subtilis (strain 168) GN=yutK PE=3 SV=1 182 583 1.0E-74
sp|Q62773|S28A2_RAT Sodium/nucleoside cotransporter 2 OS=Rattus norvegicus GN=Slc28a2 PE=1 SV=1 175 582 6.0E-74
sp|O43868|S28A2_HUMAN Sodium/nucleoside cotransporter 2 OS=Homo sapiens GN=SLC28A2 PE=2 SV=2 175 582 2.0E-73
sp|Q62674|S28A1_RAT Sodium/nucleoside cotransporter 1 OS=Rattus norvegicus GN=Slc28a1 PE=1 SV=1 175 582 3.0E-73
sp|Q9HAS3|S28A3_HUMAN Solute carrier family 28 member 3 OS=Homo sapiens GN=SLC28A3 PE=1 SV=1 177 588 4.0E-73
sp|O62667|S28A1_PIG Sodium/nucleoside cotransporter 1 OS=Sus scrofa GN=SLC28A1 PE=2 SV=1 175 582 2.0E-72
sp|O88627|S28A2_MOUSE Sodium/nucleoside cotransporter 2 OS=Mus musculus GN=Slc28a2 PE=1 SV=2 153 582 2.0E-71
sp|Q9MZT2|S28A1_RABIT Sodium/nucleoside cotransporter 1 OS=Oryctolagus cuniculus GN=SLC28A1 PE=2 SV=1 175 582 5.0E-71
sp|O00337|S28A1_HUMAN Sodium/nucleoside cotransporter 1 OS=Homo sapiens GN=SLC28A1 PE=1 SV=2 173 582 1.0E-70
sp|P44742|Y519_HAEIN Uncharacterized transporter HI_0519 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_0519 PE=3 SV=1 181 583 7.0E-69
sp|O25792|NUPC_HELPY Nucleoside permease NupC OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=nupC PE=3 SV=1 181 583 2.0E-53
sp|P33021|NUPX_ECOLI Putative nucleoside permease NupX OS=Escherichia coli (strain K12) GN=nupX PE=1 SV=1 181 583 4.0E-48
sp|P33024|PSUT_ECOLI Putative pseudouridine transporter OS=Escherichia coli (strain K12) GN=psuT PE=1 SV=1 181 583 7.0E-43
sp|P0AFF2|NUPC_ECOLI Nucleoside permease NupC OS=Escherichia coli (strain K12) GN=nupC PE=1 SV=1 185 583 3.0E-31
sp|P0AFF3|NUPC_ECOL6 Nucleoside permease NupC OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=nupC PE=3 SV=1 185 583 3.0E-31
sp|P39141|NUPC_BACSU Nucleoside permease NupC OS=Bacillus subtilis (strain 168) GN=nupC PE=2 SV=4 180 582 7.0E-28
sp|P42312|NUPG_BACSU Purine nucleoside transport protein NupG OS=Bacillus subtilis (strain 168) GN=nupG PE=1 SV=2 180 583 3.0E-25
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 66 0.45

Transmembrane Domains

Domain # Start End Length
1 72 94 22
2 104 126 22
3 147 166 19
4 176 195 19
5 202 224 22
6 262 284 22
7 297 319 22
8 339 361 22
9 430 452 22
10 462 481 19
11 524 546 22
12 561 583 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2028
MVAAHLDSARDGPARTSDADYKAEKTDVPTADFGDAEKGEAGQGSTELTSAPGDDAVAGRSRFRRLDSRHRRILV
HIVIFLVFTGWWIASLILHRHDKSWIVPFLLWLAIILRLVFYYVPIRYVSGPIRWLWRHSALVVYDAIPSRFRTL
VGGLAAVAVVLVGSFVTEESADNTRANRAVSLFGMAVILLAFYLTSAARRRINWRTVIVGMLTQYVIGLFVLRTS
VGYDIFKFIAERAGDLLGFAKDGVGFLTTPDVARLPWFLLGVVPAIIFFISLVQVLYHIGFLQWFIRKFATFVFW
AMGVSGAEAVVAAATPFIGQGESAMLVRPFVPHMTRAEIHQILTCGFATISGSVLVGYIGLGLNPEALVSSCIMS
IPASLAISKLRYPETEETLTAGRVVLPEDEDNKAENGLHAFANGAWLGIKIGGTIIASLLCILAAVGLVNGLLSW
WGRYLDINDPQLTLQTILSYVFYPIAFLLGVPRNGDLLKVAKLIAEKVVTNEYNAFTKLAHDPEYANLSARSQLI
ATYAVCGFGNIGSLGIQIGILGQLAPSRGGDVSRLALSALVSGVMSTLTSATVAGLVVTTQINNFTRGGASS*
Coding >Ophun1|2028
ATGGTCGCTGCTCACCTCGACTCGGCCCGTGACGGCCCCGCCCGGACCTCCGACGCCGACTACAAGGCCGAGAAG
ACGGACGTGCCGACGGCCGACTTTGGGGATGCCGAGAAGGGAGAGGCTGGTCAGGGATCGACGGAGCTGACGTCG
GCCCCTGGTGATGATGCCGTCGCTGGCCGCTCTCGTTTCCGACGTCTCGATAGCCGCCATCGTCGCATCTTGGTC
CACATCGTCATCTTCCTCGTCTTTACCGGCTGGTGGATCGCCTCGCTCATCCTCCACCGGCACGACAAGAGTTGG
ATCGTGCCGTTTCTGCTGTGGCTAGCCATCATCCTCCGCCTCGTCTTCTACTACGTTCCCATCCGGTACGTGTCC
GGGCCGATCCGCTGGCTATGGCGCCACTCGGCCCTCGTCGTGTACGATGCCATACCGTCTCGCTTCCGGACTCTG
GTCGGCGGCCTCGCTGCCGTTGCCGTCGTCCTCGTCGGCTCCTTTGTTACGGAGGAGAGTGCGGATAACACGCGG
GCTAACAGGGCCGTAAGCCTCTTTGGCATGGCCGTCATCCTCTTGGCTTTTTACCTGACGAGCGCGGCTCGACGG
CGTATCAACTGGCGGACCGTCATCGTCGGCATGTTGACGCAGTATGTCATCGGCCTCTTCGTTCTACGCACCTCG
GTGGGCTACGACATCTTCAAGTTCATCGCCGAGAGGGCCGGCGATCTGCTCGGCTTCGCAAAGGACGGTGTCGGC
TTCCTGACGACGCCCGACGTGGCCCGTCTCCCCTGGTTCCTACTCGGCGTCGTCCCGGCCATCATCTTCTTCATC
TCGCTCGTCCAGGTGCTCTATCACATCGGCTTCCTGCAGTGGTTCATCCGCAAGTTCGCCACCTTTGTCTTTTGG
GCCATGGGCGTTTCCGGCGCAGAGGCCGTCGTCGCCGCTGCCACGCCCTTTATCGGTCAGGGCGAGTCGGCCATG
CTGGTCCGCCCCTTTGTGCCGCACATGACGCGCGCAGAGATTCATCAGATCCTCACCTGCGGCTTCGCCACCATC
TCGGGCTCCGTCCTCGTCGGCTACATCGGCCTCGGCCTCAACCCAGAAGCCCTCGTCTCGTCGTGCATCATGTCC
ATCCCCGCCTCGCTCGCCATCTCCAAGCTGCGCTACCCGGAGACGGAGGAGACGCTGACGGCCGGCCGCGTGGTG
CTGCCAGAAGACGAGGACAACAAGGCCGAGAACGGGCTTCATGCCTTTGCCAACGGCGCCTGGCTGGGCATCAAG
ATTGGCGGCACCATCATTGCCTCGCTGCTGTGCATCCTGGCTGCCGTCGGGCTCGTCAACGGCCTGCTGTCGTGG
TGGGGGCGATATCTCGACATCAACGACCCGCAGTTGACGCTACAGACCATCTTATCCTACGTGTTTTACCCCATC
GCCTTTCTCCTTGGCGTCCCGCGCAACGGCGACCTCCTCAAGGTGGCCAAGCTGATAGCCGAGAAGGTAGTGACG
AACGAATACAACGCCTTCACCAAGCTCGCCCACGACCCCGAATACGCCAACCTCTCCGCCCGCTCCCAGCTCATC
GCCACCTACGCCGTCTGCGGCTTCGGCAACATCGGCTCCCTCGGCATCCAGATCGGCATCCTCGGCCAGCTCGCC
CCCTCGCGCGGCGGCGACGTCTCCAGGCTCGCCCTCTCCGCCCTCGTCTCGGGCGTCATGTCGACGCTCACATCG
GCCACCGTCGCCGGCCTCGTCGTCACCACTCAGATCAATAACTTTACTCGCGGGGGGGCTTCTTCGTGA
Transcript >Ophun1|2028
ATGGTCGCTGCTCACCTCGACTCGGCCCGTGACGGCCCCGCCCGGACCTCCGACGCCGACTACAAGGCCGAGAAG
ACGGACGTGCCGACGGCCGACTTTGGGGATGCCGAGAAGGGAGAGGCTGGTCAGGGATCGACGGAGCTGACGTCG
GCCCCTGGTGATGATGCCGTCGCTGGCCGCTCTCGTTTCCGACGTCTCGATAGCCGCCATCGTCGCATCTTGGTC
CACATCGTCATCTTCCTCGTCTTTACCGGCTGGTGGATCGCCTCGCTCATCCTCCACCGGCACGACAAGAGTTGG
ATCGTGCCGTTTCTGCTGTGGCTAGCCATCATCCTCCGCCTCGTCTTCTACTACGTTCCCATCCGGTACGTGTCC
GGGCCGATCCGCTGGCTATGGCGCCACTCGGCCCTCGTCGTGTACGATGCCATACCGTCTCGCTTCCGGACTCTG
GTCGGCGGCCTCGCTGCCGTTGCCGTCGTCCTCGTCGGCTCCTTTGTTACGGAGGAGAGTGCGGATAACACGCGG
GCTAACAGGGCCGTAAGCCTCTTTGGCATGGCCGTCATCCTCTTGGCTTTTTACCTGACGAGCGCGGCTCGACGG
CGTATCAACTGGCGGACCGTCATCGTCGGCATGTTGACGCAGTATGTCATCGGCCTCTTCGTTCTACGCACCTCG
GTGGGCTACGACATCTTCAAGTTCATCGCCGAGAGGGCCGGCGATCTGCTCGGCTTCGCAAAGGACGGTGTCGGC
TTCCTGACGACGCCCGACGTGGCCCGTCTCCCCTGGTTCCTACTCGGCGTCGTCCCGGCCATCATCTTCTTCATC
TCGCTCGTCCAGGTGCTCTATCACATCGGCTTCCTGCAGTGGTTCATCCGCAAGTTCGCCACCTTTGTCTTTTGG
GCCATGGGCGTTTCCGGCGCAGAGGCCGTCGTCGCCGCTGCCACGCCCTTTATCGGTCAGGGCGAGTCGGCCATG
CTGGTCCGCCCCTTTGTGCCGCACATGACGCGCGCAGAGATTCATCAGATCCTCACCTGCGGCTTCGCCACCATC
TCGGGCTCCGTCCTCGTCGGCTACATCGGCCTCGGCCTCAACCCAGAAGCCCTCGTCTCGTCGTGCATCATGTCC
ATCCCCGCCTCGCTCGCCATCTCCAAGCTGCGCTACCCGGAGACGGAGGAGACGCTGACGGCCGGCCGCGTGGTG
CTGCCAGAAGACGAGGACAACAAGGCCGAGAACGGGCTTCATGCCTTTGCCAACGGCGCCTGGCTGGGCATCAAG
ATTGGCGGCACCATCATTGCCTCGCTGCTGTGCATCCTGGCTGCCGTCGGGCTCGTCAACGGCCTGCTGTCGTGG
TGGGGGCGATATCTCGACATCAACGACCCGCAGTTGACGCTACAGACCATCTTATCCTACGTGTTTTACCCCATC
GCCTTTCTCCTTGGCGTCCCGCGCAACGGCGACCTCCTCAAGGTGGCCAAGCTGATAGCCGAGAAGGTAGTGACG
AACGAATACAACGCCTTCACCAAGCTCGCCCACGACCCCGAATACGCCAACCTCTCCGCCCGCTCCCAGCTCATC
GCCACCTACGCCGTCTGCGGCTTCGGCAACATCGGCTCCCTCGGCATCCAGATCGGCATCCTCGGCCAGCTCGCC
CCCTCGCGCGGCGGCGACGTCTCCAGGCTCGCCCTCTCCGCCCTCGTCTCGGGCGTCATGTCGACGCTCACATCG
GCCACCGTCGCCGGCCTCGTCGTCACCACTCAGATCAATAACTTTACTCGCGGGGGGGCTTCTTCGTGA
Gene >Ophun1|2028
ATGGTCGCTGCTCACCTCGACTCGGCCCGTGACGGCCCCGCCCGGACCTCCGACGCCGACTACAAGGCCGAGAAG
ACGGACGTGCCGACGGCCGACTTTGGGGATGCCGAGAAGGGAGAGGCTGGTCAGGGATCGACGGAGCTGACGTCG
GCCCCTGGTGATGATGCCGTCGCTGGCCGCTCTCGTTTCCGACGTCTCGATAGCCGCCATCGTCGCATCTTGGTC
CACATCGTCATCTTCCTCGTCTTTACCGGCTGGTGGATCGCCTCGCTCATCCTCCACCGGCACGACAAGAGTTGG
ATCGTGCCGTTTCTGCTGTGGCTAGCCATCATCCTCCGCCTCGTCTTCTACTACGTTCCCATCCGGTACGTGTCC
GGGCCGATCCGCTGGCTATGGCGCCACTCGGCCCTCGTCGTGTACGATGCCATACCGTCTCGCTTCCGGACTCTG
GTCGGCGGCCTCGCTGCCGTTGCCGTCGTCCTCGTCGGCTCCTTTGTTACGGAGGAGAGTGCGGATAACACGCGG
GCTAACAGGGCCGTAAGCCTCTTTGGCATGGCCGTCATCCTCTTGGCTTTTTACCTGACGAGCGCGGCTCGACGG
CGTATCAACTGGCGGACCGTCATCGTCGGCATGTTGACGCAGTATGTCATCGGCCTCTTCGTTCTACGCACCTCG
GTGGGCTACGACATCTTCAAGTTCATCGCCGAGAGGGCCGGCGATCTGCTCGGCTTCGCAAAGGACGGTGTCGGC
TTCCTGACGACGCCCGACGTGGCCCGTCTCCCCTGGTTCCTACTCGGCGTCGTCCCGGCCATCATCTTCTTCATC
TCGCTCGTCCAGGTGCTCTATCACATCGGCTTCCTGCAGTGGTTCATCCGCAAGTTCGCCACCTTTGTCTTTTGG
GCCATGGGCGTTTCCGGCGCAGAGGCCGTCGTCGCCGCTGCCACGCCCTTTATCGGTCAGGGCGAGTCGGCCATG
CTGGTCCGCCCCTTTGTGCCGCACATGACGCGCGCAGAGATTCATCAGATCCTCACCTGCGGCTTCGCCACCATC
TCGGGCTCCGTCCTCGTCGGCTACATCGGCCTCGGCCTCAACCCAGAAGCCCTCGTCTCGTCGTGCATCATGTCC
ATCCCCGCCTCGCTCGCCATCTCCAAGCTGCGCTACCCGGAGACGGAGGAGACGCTGACGGCCGGCCGCGTGGTG
CTGCCAGAAGACGAGGACAACAAGGCCGAGAACGGGCTTCATGCCTTTGCCAACGGCGCCTGGCTGGGCATCAAG
ATTGGCGGCACCATCATTGCCTCGCTGCTGTGCATCCTGGCTGCCGTCGGGCTCGTCAACGGCCTGCTGTCGTGG
TGGGGGCGATATCTCGACATCAACGACCCGCAGTTGACGCTACAGACCATCTTATCCTACGTGTTTTACCCCATC
GCCTTTCTCCTTGGCGTCCCGCGCAACGGCGACCTCCTCAAGGTGGCCAAGCTGATAGCCGAGAAGGTAGTGACG
GTAAGCCTCCTGTCCTCTCCTGCATCTACAACCCAACTCACAACCTTGCCCAGAACGAATACAACGCCTTCACCA
AGCTCGCCCACGACCCCGAATACGCCAACCTCTCCGCCCGCTCCCAGCTCATCGCCACCTACGCCGTCTGCGGCT
TCGGCAACATCGGCTCCCTCGGCATCCAGATCGGCATCCTCGGCCAGCTCGCCCCCTCGCGCGGCGGCGACGTCT
CCAGGCTCGCCCTCTCCGCCCTCGTCTCGGGCGTCATGTCGACGCTCACATCGGCCACCGTCGCCGGCCTCGTCG
TCACCACTCAGATCAATAACTTTACTCGCGGGGGGGCTTCTTCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail