Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2027
Gene name
LocationContig_194:9740..20334
Strand+
Gene length (bp)10594
Transcript length (bp)9816
Coding sequence length (bp)9816
Protein length (aa) 3272

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06650 SHR-BD SHR-binding domain of vacuolar-sorting associated protein 13 2.1E-91 2335 2617
PF16910 VPS13_mid_rpt Repeating coiled region of VPS13 7.1E-89 646 882
PF16908 VPS13 Vacuolar sorting-associated protein 13, N-terminal 1.2E-85 193 432
PF16909 VPS13_C Vacuolar-sorting-associated 13 protein C-terminal 3.0E-70 2867 3042
PF12624 Chorein_N N-terminal region of Chorein or VPS13 1.7E-39 56 169

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P87319|VP13A_SCHPO Vacuolar protein sorting-associated protein 13a OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vps13a PE=3 SV=2 55 3215 0.0E+00
sp|O42926|VP13B_SCHPO Vacuolar protein sorting-associated protein 13b OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vps13b PE=2 SV=1 55 3195 0.0E+00
sp|Q07878|VPS13_YEAST Vacuolar protein sorting-associated protein 13 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VPS13 PE=1 SV=1 55 3265 0.0E+00
sp|Q96RL7|VP13A_HUMAN Vacuolar protein sorting-associated protein 13A OS=Homo sapiens GN=VPS13A PE=1 SV=2 55 1363 2.0E-99
sp|Q8BX70|VP13C_MOUSE Vacuolar protein sorting-associated protein 13C OS=Mus musculus GN=Vps13c PE=1 SV=2 55 1442 8.0E-99
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P87319|VP13A_SCHPO Vacuolar protein sorting-associated protein 13a OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vps13a PE=3 SV=2 55 3215 0.0E+00
sp|O42926|VP13B_SCHPO Vacuolar protein sorting-associated protein 13b OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vps13b PE=2 SV=1 55 3195 0.0E+00
sp|Q07878|VPS13_YEAST Vacuolar protein sorting-associated protein 13 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VPS13 PE=1 SV=1 55 3265 0.0E+00
sp|Q96RL7|VP13A_HUMAN Vacuolar protein sorting-associated protein 13A OS=Homo sapiens GN=VPS13A PE=1 SV=2 55 1363 2.0E-99
sp|Q8BX70|VP13C_MOUSE Vacuolar protein sorting-associated protein 13C OS=Mus musculus GN=Vps13c PE=1 SV=2 55 1442 8.0E-99
sp|Q54LB8|VP13A_DICDI Putative vacuolar protein sorting-associated protein 13A OS=Dictyostelium discoideum GN=vps13A PE=2 SV=1 55 1116 4.0E-97
sp|Q5H8C4|VP13A_MOUSE Vacuolar protein sorting-associated protein 13A OS=Mus musculus GN=Vps13a PE=1 SV=1 55 1392 9.0E-96
sp|Q54LB8|VP13A_DICDI Putative vacuolar protein sorting-associated protein 13A OS=Dictyostelium discoideum GN=vps13A PE=2 SV=1 1870 3206 3.0E-93
sp|Q709C8|VP13C_HUMAN Vacuolar protein sorting-associated protein 13C OS=Homo sapiens GN=VPS13C PE=1 SV=1 55 1629 4.0E-91
sp|Q555C6|VP13B_DICDI Putative vacuolar protein sorting-associated protein 13B OS=Dictyostelium discoideum GN=vps13B PE=3 SV=1 55 738 3.0E-79
sp|Q55EI3|VP13E_DICDI Putative vacuolar protein sorting-associated protein 13E OS=Dictyostelium discoideum GN=vps13E PE=3 SV=1 2109 3257 3.0E-73
sp|Q55FG3|VP13C_DICDI Putative vacuolar protein sorting-associated protein 13C OS=Dictyostelium discoideum GN=tipC PE=3 SV=1 55 877 1.0E-69
sp|Q55FG3|VP13C_DICDI Putative vacuolar protein sorting-associated protein 13C OS=Dictyostelium discoideum GN=tipC PE=3 SV=1 2600 3238 5.0E-69
sp|Q5THJ4|VP13D_HUMAN Vacuolar protein sorting-associated protein 13D OS=Homo sapiens GN=VPS13D PE=1 SV=2 55 873 1.0E-66
sp|Q5H8C4|VP13A_MOUSE Vacuolar protein sorting-associated protein 13A OS=Mus musculus GN=Vps13a PE=1 SV=1 2708 3211 2.0E-61
sp|Q8BX70|VP13C_MOUSE Vacuolar protein sorting-associated protein 13C OS=Mus musculus GN=Vps13c PE=1 SV=2 2732 3217 3.0E-61
sp|Q96RL7|VP13A_HUMAN Vacuolar protein sorting-associated protein 13A OS=Homo sapiens GN=VPS13A PE=1 SV=2 2708 3211 7.0E-61
sp|Q709C8|VP13C_HUMAN Vacuolar protein sorting-associated protein 13C OS=Homo sapiens GN=VPS13C PE=1 SV=1 2732 3217 1.0E-60
sp|Q9BGZ0|VP13A_MACFA Vacuolar protein sorting-associated protein 13A (Fragment) OS=Macaca fascicularis GN=VPS13A PE=2 SV=1 2747 3169 7.0E-57
sp|Q54KX3|VP13F_DICDI Putative vacuolar protein sorting-associated protein 13F OS=Dictyostelium discoideum GN=vps13F PE=3 SV=1 2709 3188 2.0E-51
sp|Q555C6|VP13B_DICDI Putative vacuolar protein sorting-associated protein 13B OS=Dictyostelium discoideum GN=vps13B PE=3 SV=1 2710 3230 4.0E-50
sp|Q54LN2|VP13D_DICDI Putative vacuolar protein sorting-associated protein 13D OS=Dictyostelium discoideum GN=vps13D PE=3 SV=1 2868 3230 1.0E-48
sp|Q8BX70|VP13C_MOUSE Vacuolar protein sorting-associated protein 13C OS=Mus musculus GN=Vps13c PE=1 SV=2 1025 2478 5.0E-47
sp|Q709C8|VP13C_HUMAN Vacuolar protein sorting-associated protein 13C OS=Homo sapiens GN=VPS13C PE=1 SV=1 620 2525 8.0E-43
sp|Q54KX3|VP13F_DICDI Putative vacuolar protein sorting-associated protein 13F OS=Dictyostelium discoideum GN=vps13F PE=3 SV=1 192 474 2.0E-42
sp|Q5THJ4|VP13D_HUMAN Vacuolar protein sorting-associated protein 13D OS=Homo sapiens GN=VPS13D PE=1 SV=2 2654 3171 4.0E-38
sp|Q5THJ4|VP13D_HUMAN Vacuolar protein sorting-associated protein 13D OS=Homo sapiens GN=VPS13D PE=1 SV=2 1507 2615 4.0E-30
sp|Q7Z7G8|VP13B_HUMAN Vacuolar protein sorting-associated protein 13B OS=Homo sapiens GN=VPS13B PE=1 SV=2 2917 3125 9.0E-20
sp|Q80TY5|VP13B_MOUSE Vacuolar protein sorting-associated protein 13B OS=Mus musculus GN=Vps13b PE=1 SV=2 2917 3125 1.0E-19
sp|Q55EI3|VP13E_DICDI Putative vacuolar protein sorting-associated protein 13E OS=Dictyostelium discoideum GN=vps13E PE=3 SV=1 255 794 2.0E-19
sp|Q54KX3|VP13F_DICDI Putative vacuolar protein sorting-associated protein 13F OS=Dictyostelium discoideum GN=vps13F PE=3 SV=1 55 177 2.0E-19
sp|Q55EI3|VP13E_DICDI Putative vacuolar protein sorting-associated protein 13E OS=Dictyostelium discoideum GN=vps13E PE=3 SV=1 55 247 8.0E-14
sp|Q54LN2|VP13D_DICDI Putative vacuolar protein sorting-associated protein 13D OS=Dictyostelium discoideum GN=vps13D PE=3 SV=1 55 143 1.0E-12
sp|Q5H8C4|VP13A_MOUSE Vacuolar protein sorting-associated protein 13A OS=Mus musculus GN=Vps13a PE=1 SV=1 1903 2484 2.0E-11
sp|Q96RL7|VP13A_HUMAN Vacuolar protein sorting-associated protein 13A OS=Homo sapiens GN=VPS13A PE=1 SV=2 1903 2730 5.0E-11
sp|Q7Z7G8|VP13B_HUMAN Vacuolar protein sorting-associated protein 13B OS=Homo sapiens GN=VPS13B PE=1 SV=2 55 197 1.0E-10
sp|Q54KX3|VP13F_DICDI Putative vacuolar protein sorting-associated protein 13F OS=Dictyostelium discoideum GN=vps13F PE=3 SV=1 639 766 2.0E-10
sp|Q80TY5|VP13B_MOUSE Vacuolar protein sorting-associated protein 13B OS=Mus musculus GN=Vps13b PE=1 SV=2 55 197 2.0E-10
sp|Q86K84|VP13L_DICDI Vacuolar protein sorting-associated protein 13-like protein OS=Dictyostelium discoideum GN=vps13l PE=3 SV=1 2941 3138 2.0E-10
sp|Q5THJ4|VP13D_HUMAN Vacuolar protein sorting-associated protein 13D OS=Homo sapiens GN=VPS13D PE=1 SV=2 1045 1354 1.0E-08
sp|Q54PG5|GACC_DICDI Rho GTPase-activating protein gacC OS=Dictyostelium discoideum GN=gacC PE=3 SV=1 3053 3134 2.0E-08
sp|Q54LN2|VP13D_DICDI Putative vacuolar protein sorting-associated protein 13D OS=Dictyostelium discoideum GN=vps13D PE=3 SV=1 197 371 3.0E-08
sp|Q54LN2|VP13D_DICDI Putative vacuolar protein sorting-associated protein 13D OS=Dictyostelium discoideum GN=vps13D PE=3 SV=1 2709 2829 1.0E-07
sp|Q555C6|VP13B_DICDI Putative vacuolar protein sorting-associated protein 13B OS=Dictyostelium discoideum GN=vps13B PE=3 SV=1 2442 2617 3.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 63 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2027
MEQAAVETRPTDYRLPEWSPGALQRPGTETAVQSPNSHAPNPFPGPGHGIPAFAMLEGLAAGLLNRFLGMYVQNF
DPTQLKVGIWSGDVKLRNLELRREALDQLKLPINVVEGHLGELTLIIPWSNLRGAPVKVFVEDVFLLASPKEEAE
YDQKEEEQRSQRLKMEKLDSAELLKEKNREGMSPEEQQKNQSFTQSLVTKIVDNLQITVKNIHIRYEDSISAPGH
PFALGLTLEQFSAVSTDGDWKPTFIQNSTVITNKLATLGALAVYWNTDTDLMGSGREAALPPDEAMSHEDMVTKF
RSLIDTTASSDHQFILKPVSGQAKIELNKSGDVVAPKFKVNLLFEEIGLVLDDHQYRDALMMADLFHYFIRHQEY
RALKPKGVRPDQDPRAWFKFAGNAVLGNIHERNRKWSWDYFRERRDDRIRYIELFKKKKEQQQLSPDEEEDIVTL
EWKLGYEDLRFWRSLARNQLKKENAEALKRRAQQPEQQGWMSWIWGSKPQGKIEKNEENTQMTEEQRKELYDMID
WDEKTALAEAIDVPREAVKLCIEACLGTGSFTLRQGSHGKAPRDLLGLYFDVFKAKALQRKDSLLANVSLGGLRV
EDGTTPDSLYPEIVRVKDAPGTKQRKRLSLAELEKSSDEPFFQFEVEQNPIEREGDIAVMGSLKPLEVVWNPNFV
VGIVDFFRPPERHMESITALMETAGATVEGIREQTRAGLEFALEEHKTINAELSLQAPLIIVPVSITARESTCVI
VDAGHIHVNSQLVDQDTMKEIQAKQRQTYSEEDFKRLESVMYDKFIVKLTSTQVLIGPSIEKTKAELIRRSEGSQ
LHVVEKINVDFVVETSILPKAPNLTKFRVSGHMPMLHASVSDSKYKNLMKIIDVAIPKLGGESQQDEAPASKTDE
GGHPRATTPQQQTRQPSRPRLASSGSNKSPRRKSQRENRQSAGFPFLQPPSAVVLDDMDDDQDDFEDASDGADGQ
QLKIQQRSFEFNFKVDTLKGSLYRSDPDCIKPDALLVELVAERFDLAFYTRLYDMSAEVSLGAVSVDDFVDNPPA
EFKSIVSSGDSDDLQEGRSLVHVKYMDVKPQSPEFMPVYEGVKTNISASVSTINLVVTRKTLLTLLDFILVTFAG
GNNDQEQSRTVITDGQETGYEETATEPAKQNVDSGSIRVKVDLKGIRLILNNDGIRLATLSLTEADAGIFLRGNT
MRIFAKLGDLSLVDDVNLGVSSDSNLRRLVTIQGDELADFRYETFDADNKHAYPGHDSAIFLRAGSVKVNFVEEP
FRKIIDFLVKFGRMQALYNAARQAAVTRANQMQQSPSRFKFDVVIKTPIVVFPRLMVSESPERDVVTAYLGEIYA
QNEFAPLDDAEDSRIAMKISTGIRKIRLTSDFYYDNDRSEELEMIDQVDLGLSITYAEHKPGAMRPDTEIEASMS
DIKLRLTQHQLKFLLEISKAVPAAFAGDGSTGDEEAAQLVDEETLRRARTASADDGISPDQHAVDLGPELKSPTD
TWTQLDLIFRVDTIGLELIRAPLDEPVGDLAASSLSRFSLDETKVKTRMMSDGSLEAELLIRSLTIYDSRPKGVN
KFRRIMSSSNKESQQLMASVTMSGGKERSMIAMATIDSPRVIFALDYLFAIQAFAAEGLKVEDSSPLDDISTDES
PESSEDADSVRVSSTKPGRSQVTSPRRSESSSSELQKRQGEASMSLALRINLVDAQVILIANPLRSNSEAIVLGI
RQVLLSQQNALTFQVSEMGMFLCAMDRFETSRLRIIDDFSIQLNMDSSQPFMTSYHVDVEPLIVRLSLRDILLVL
QIVAKAGELSESGKEPVKETPAEHKVKQLRGASTKSKAPSGRALSTAAQTKANQAVVAKGAAATKARGRTTHEEL
SATLQGMRVVLIGDLHELPIIDVGVKEFTATAENWSSNLKAEAAIHTYTNVYNFSKSSWEPLIEPWQVGLGVARD
STTGVLSVDVASAKTLDITVTTATIALASKSLAFLTTQEDVLDKPRWSDAPYRIRNHTGFVITMHSRSPSSEEFI
DLRLEDGEEAPWTFEEWEKMRENILTEAAAQNDVGIKLEGSGFDTVKNVRVNREGEFLYSLRPKTDNVTHRLCVD
VRLGSDNVKDVTLRSPLLVENATEIPVELGIYDASEGHLLKIEKIAPGDSRPAPVGAAFEKRVIVRPDSGFGYQW
SRDQLWWRDLLKRPTKQLVCIGDTGDSFYFQVHADFDKTNPLTKAYPSMKIKLSAPLTLENLLPYDFKYRIYDRN
TKRDWSNFLRKGGVSPVHMVELSHLLLLSVDMQDTIFKPSDFSIINPGSNDDFRKENRLVVKDEQGLTLHLSLHY
FKVPKSGGAFKISVYSPYVVLNKTGLDMRIRAKSFLQQAKAAAGQFPVVQTGSQDRPKALPFMFSFGNDEHQNRV
LLKVDESEWSKPQSFDAVGSTSEVILNSSTSKHREIHLGITVKSGDGKYKMTRVVTLAPRFVLVNKLGEEILVRE
SGSSNHMTIRSGVLHPLHFMQKSAVKQLCLCFPGVDNHWTSPFNIADLGTTHVKMTRAGQRQRLVRLEILTEEST
IFLHMSIEGKHWPFSMRNESDTEFSFYQANPNVDEDDDEDRSGWKPVRYRLPPRSVMPYAWDFPAAKFREVVIST
CGKERHVKLAEMGNQIPMKFTGPGGQQKIIDINVAADGPMQTLILSNFRASRSMFKPAAVSRTNTGPEAFEVKDQ
GTGATMLAQLKLSGIGISLINAHLKELAYVTLREVQLRLSDSPLIQTMSLAVKWIQIDNQLYGGIFPIVLYPSVV
PKRANEVEAHPSLHAMVSRVKDDSYGVLYIKYATVLLQQMTVDLDEDFVFALLDFSNVPGASWTAVEGSGSGRLC
DEDLDIPEPSQQQSGQDMYFEVLNIQPMQIDLSFVRTERVNAEDKTSTRNPIMFFLNVMTMAIGNVNDAPVRFNA
LMLDNVRVSQAVLVQNVSSHYSQEVMYQIHKILGSADFLGNPVGLFNNISSGVTDIFYEPYQGLILSDRPEEFGI
GIARGAVSFAKKTVYGFSDSFSKFTGSLGKGLAAASLDKQFQDRRRITRARNRPKHALYGVAAGANSLLTSVASG
VGGLARKPLEGAEQEGALGFFKGVGKGVLGLATKPAVGVLDMASNVSEGIRNTTTVFDGSELERTRLPRFMANDG
IVRPYGAREALGQFWLKQVDNGKYFDEQYVGHLELPREDMVVMVTFARILLIRSRRLTSEWDVKLKDVQTVAKER
TGVSLTLRGGTNGPFIPVGGGSERGYLYRMIGVAAEEFNRRFRGAE*
Coding >Ophun1|2027
ATGGAGCAGGCGGCCGTCGAGACAAGACCCACCGACTATCGGCTTCCCGAGTGGTCTCCCGGGGCTCTGCAGCGA
CCAGGAACCGAGACAGCGGTGCAGAGCCCCAATTCACACGCTCCGAACCCCTTTCCCGGCCCGGGTCACGGCATC
CCGGCCTTCGCCATGCTCGAGGGGCTCGCGGCCGGACTGCTCAACCGCTTCTTGGGCATGTACGTCCAGAACTTC
GATCCCACCCAGCTCAAGGTCGGCATCTGGTCTGGCGACGTCAAGCTCCGCAACCTCGAGCTCCGGCGCGAGGCC
CTCGATCAGCTCAAGCTGCCCATCAACGTCGTCGAGGGCCATCTCGGCGAGCTGACGCTCATAATCCCGTGGTCC
AACCTTCGAGGCGCCCCGGTCAAGGTCTTCGTCGAGGACGTCTTCCTGCTCGCCAGTCCAAAGGAAGAGGCCGAA
TATGACCAGAAGGAGGAGGAGCAACGGAGCCAGCGGCTCAAGATGGAGAAGCTCGACAGCGCCGAGCTGCTCAAG
GAGAAGAATCGAGAGGGCATGAGTCCTGAGGAGCAGCAAAAGAACCAGAGCTTCACGCAGAGTCTCGTCACAAAG
ATTGTCGACAACCTGCAAATCACCGTCAAGAACATCCATATCCGATACGAAGATTCCATCTCCGCCCCCGGCCAT
CCCTTTGCCCTCGGCCTCACGCTCGAACAGTTCTCGGCTGTCAGCACCGACGGCGACTGGAAGCCGACTTTTATA
CAAAACTCGACCGTCATCACCAATAAGCTGGCCACGCTCGGAGCCCTGGCCGTTTACTGGAACACAGACACTGAT
CTCATGGGCAGTGGGCGCGAAGCTGCGCTGCCGCCTGACGAGGCCATGTCCCATGAAGACATGGTGACCAAGTTT
CGCTCCCTCATCGACACGACCGCCTCTTCGGATCATCAGTTCATTCTGAAGCCCGTCAGCGGCCAGGCCAAGATC
GAGCTCAACAAGTCGGGCGATGTTGTCGCCCCCAAGTTCAAGGTCAACCTGCTGTTCGAGGAGATCGGTCTCGTG
CTCGACGACCACCAATACCGCGATGCCCTGATGATGGCCGATCTGTTCCACTACTTCATCCGCCATCAGGAGTAC
CGAGCGCTGAAGCCCAAGGGCGTTCGACCGGACCAGGATCCCCGAGCTTGGTTTAAATTCGCAGGCAACGCCGTG
CTCGGCAACATCCACGAGCGAAACCGCAAGTGGTCCTGGGACTATTTCAGGGAGCGGCGCGACGATCGCATCCGC
TACATCGAACTCTTCAAGAAGAAAAAGGAGCAGCAACAGCTGTCGCCGGACGAAGAAGAGGATATCGTGACTCTG
GAGTGGAAGCTGGGATATGAAGACTTGCGCTTCTGGCGGTCCCTGGCCCGGAACCAGCTCAAAAAGGAAAACGCG
GAGGCTTTGAAAAGACGAGCCCAGCAGCCCGAGCAGCAGGGCTGGATGTCATGGATCTGGGGCTCGAAGCCCCAG
GGAAAGATTGAGAAGAACGAGGAGAACACTCAGATGACCGAGGAGCAGCGCAAGGAGCTGTACGACATGATCGAC
TGGGACGAGAAGACGGCCCTGGCGGAGGCCATCGACGTGCCGCGTGAGGCCGTCAAGCTCTGCATCGAGGCCTGT
CTCGGCACCGGGAGCTTCACCCTCAGACAGGGCAGCCACGGAAAAGCCCCGAGAGACCTGCTTGGGTTATACTTT
GACGTCTTCAAAGCAAAGGCTCTACAGCGCAAGGACTCGCTGCTCGCAAACGTCAGTCTCGGAGGGTTGCGGGTC
GAGGACGGCACGACACCAGACAGCCTGTACCCCGAGATTGTACGGGTCAAAGACGCTCCCGGAACGAAGCAGCGC
AAGAGACTATCCCTAGCGGAGCTAGAGAAGAGCAGCGATGAGCCGTTCTTTCAGTTCGAGGTGGAGCAGAACCCG
ATCGAGCGCGAGGGCGACATCGCCGTCATGGGCAGTCTGAAGCCCCTCGAGGTCGTGTGGAATCCCAACTTCGTC
GTTGGAATCGTGGACTTTTTCAGACCGCCCGAGAGGCACATGGAGTCCATCACGGCCCTCATGGAGACGGCCGGC
GCCACCGTCGAGGGCATCAGGGAGCAGACGCGCGCCGGCCTCGAGTTCGCCCTCGAGGAGCACAAGACCATCAAC
GCCGAGCTGAGCCTGCAGGCACCGCTCATCATCGTGCCCGTGAGCATCACCGCCAGGGAGTCTACGTGTGTCATC
GTCGACGCCGGCCACATTCACGTCAACAGCCAGCTGGTCGACCAGGACACCATGAAGGAAATTCAGGCCAAGCAG
CGGCAGACTTACAGCGAGGAGGATTTCAAGCGGCTCGAGTCGGTCATGTACGACAAATTCATCGTCAAGCTCACC
TCTACCCAGGTCCTCATCGGACCTTCGATCGAGAAGACCAAGGCGGAGCTCATAAGGAGAAGCGAAGGCTCCCAG
CTGCACGTCGTCGAGAAGATCAACGTCGACTTTGTCGTGGAGACGTCGATCCTGCCCAAGGCCCCCAATCTGACC
AAGTTCAGGGTTTCCGGCCATATGCCCATGCTCCACGCCTCGGTGTCTGACTCCAAGTACAAGAACCTAATGAAG
ATCATCGATGTGGCCATTCCCAAGCTCGGAGGCGAGAGTCAGCAGGACGAGGCGCCGGCGTCCAAGACCGACGAG
GGCGGGCATCCCCGAGCTACGACGCCGCAACAGCAGACACGACAGCCTTCGCGACCCCGGCTTGCAAGCAGCGGC
TCGAATAAGTCTCCTCGGCGAAAGTCCCAGCGGGAGAATCGGCAGTCGGCTGGTTTCCCCTTTCTGCAGCCGCCC
AGCGCCGTCGTGCTGGACGACATGGACGATGACCAGGACGACTTCGAGGACGCCTCAGACGGTGCAGACGGACAG
CAGCTCAAGATTCAGCAGCGGAGCTTCGAGTTCAACTTCAAGGTCGATACTCTCAAAGGCTCGCTCTACCGCAGC
GATCCGGACTGCATCAAGCCCGACGCTCTGTTGGTCGAGCTCGTGGCTGAGCGTTTCGACCTTGCCTTTTACACG
AGGCTGTACGATATGTCTGCAGAGGTATCTCTCGGGGCTGTGTCTGTGGACGACTTCGTCGACAATCCTCCTGCA
GAGTTCAAGTCCATCGTCTCGTCCGGTGACAGTGATGACCTCCAGGAAGGACGGAGTCTGGTTCACGTCAAGTAC
ATGGATGTCAAGCCACAGTCTCCCGAGTTTATGCCCGTTTACGAGGGAGTCAAGACGAACATCAGTGCTTCGGTG
TCGACCATCAACCTCGTCGTGACGAGGAAGACGCTACTGACGCTCCTCGACTTCATTCTCGTCACCTTTGCGGGA
GGCAACAACGACCAGGAACAGAGCCGAACGGTCATTACCGATGGTCAAGAAACCGGGTACGAAGAGACGGCTACG
GAGCCGGCTAAGCAAAATGTCGACTCTGGTTCCATCAGAGTCAAGGTGGATCTGAAGGGCATCAGGCTCATCCTC
AACAACGATGGCATAAGGTTGGCGACGCTTTCGCTCACGGAGGCCGACGCCGGCATATTCCTGCGCGGAAATACG
ATGCGAATATTTGCAAAACTCGGAGATTTGTCTCTCGTCGACGACGTCAACCTGGGCGTCTCCAGCGACTCCAAC
CTGCGGAGGCTCGTCACCATCCAGGGCGACGAGCTCGCCGATTTCCGCTACGAGACGTTTGACGCGGATAACAAG
CACGCTTATCCGGGCCATGACAGCGCCATCTTCCTGCGAGCTGGTTCGGTCAAGGTGAACTTTGTCGAGGAGCCG
TTCCGCAAGATCATCGACTTCCTCGTCAAGTTTGGCAGGATGCAAGCCCTCTACAACGCTGCTCGACAGGCCGCC
GTCACACGGGCCAACCAGATGCAGCAGAGTCCCAGCAGGTTCAAGTTTGACGTGGTGATCAAGACGCCCATCGTC
GTCTTCCCCCGCTTGATGGTTTCGGAGTCTCCCGAGCGCGACGTCGTGACGGCATACCTGGGTGAGATCTATGCG
CAGAATGAGTTTGCGCCGCTCGACGACGCCGAGGACTCTCGGATCGCCATGAAAATATCCACGGGCATCAGGAAG
ATCCGGCTTACGTCCGACTTTTACTACGACAATGACAGATCGGAAGAGCTGGAGATGATAGATCAGGTCGACCTT
GGGCTCAGCATCACCTACGCTGAGCACAAGCCTGGCGCCATGCGTCCAGACACGGAGATTGAGGCGTCCATGTCG
GACATCAAGCTCAGACTCACGCAGCATCAGCTCAAGTTCCTGCTGGAGATCTCCAAAGCAGTTCCCGCTGCGTTT
GCTGGCGACGGCAGCACCGGCGACGAGGAAGCGGCTCAGCTCGTCGACGAGGAGACGCTGCGGCGTGCTAGAACC
GCGTCGGCAGACGATGGTATCAGCCCTGACCAGCACGCCGTCGACCTCGGCCCCGAGTTGAAGTCGCCTACGGAT
ACTTGGACTCAGCTCGACTTGATATTCCGAGTCGACACCATCGGTCTCGAACTCATCAGGGCCCCGCTGGACGAG
CCCGTGGGCGACTTGGCCGCTTCCAGCCTGTCTCGCTTCTCGCTTGACGAAACCAAGGTCAAGACGCGGATGATG
TCGGATGGCTCGTTGGAAGCCGAGCTGCTCATTCGTTCCTTGACCATCTACGATAGCCGTCCGAAAGGGGTCAAC
AAGTTCCGTCGCATCATGAGCTCGTCAAACAAAGAGTCGCAGCAACTCATGGCGAGCGTCACCATGTCGGGCGGC
AAGGAGCGTAGCATGATTGCCATGGCGACCATTGACAGCCCTCGCGTCATCTTCGCACTCGACTACCTCTTCGCT
ATCCAGGCGTTTGCCGCCGAAGGCCTCAAGGTGGAAGATTCCAGCCCACTGGACGATATCAGCACCGACGAGTCG
CCAGAAAGCTCGGAAGATGCAGACTCGGTGCGAGTGTCGTCCACTAAACCTGGTCGATCGCAGGTGACGTCTCCG
CGACGCAGCGAATCGAGCTCCAGCGAGCTGCAGAAGCGTCAAGGCGAGGCTTCGATGAGCTTGGCCTTGCGAATC
AACCTCGTTGACGCGCAGGTCATACTCATCGCCAACCCGCTGCGGTCCAATTCCGAAGCCATCGTACTGGGCATT
CGACAGGTGCTTCTATCGCAACAGAACGCACTCACCTTCCAGGTCTCCGAGATGGGCATGTTTCTCTGTGCCATG
GACAGGTTCGAGACGTCGCGCCTCAGAATCATCGACGACTTTTCGATCCAGTTGAACATGGACAGCTCGCAGCCA
TTCATGACCAGCTATCACGTAGATGTCGAGCCTCTCATCGTCCGACTCTCCCTGAGAGACATTCTCCTCGTGCTC
CAGATTGTCGCCAAAGCCGGCGAGCTATCGGAAAGCGGGAAAGAGCCGGTCAAAGAGACGCCAGCGGAGCACAAG
GTGAAGCAACTCAGGGGCGCCAGCACCAAGTCAAAGGCCCCCAGCGGCCGCGCTCTGTCGACAGCGGCTCAGACC
AAAGCCAACCAGGCCGTTGTCGCCAAAGGTGCCGCGGCGACCAAGGCACGCGGCAGAACCACGCATGAGGAGCTC
TCTGCGACGCTTCAGGGCATGCGAGTCGTGCTGATCGGAGACCTGCACGAGCTGCCCATTATCGACGTCGGAGTC
AAGGAGTTTACGGCGACGGCAGAGAATTGGTCGTCGAATCTGAAAGCCGAGGCGGCCATACACACGTACACGAAC
GTCTACAACTTTTCGAAATCCAGCTGGGAGCCCCTGATCGAACCATGGCAAGTCGGCCTGGGCGTGGCCAGAGAC
TCGACTACGGGCGTGCTGTCGGTCGACGTGGCCTCGGCAAAGACGCTCGATATCACAGTCACGACGGCGACCATC
GCATTGGCTTCCAAGTCGCTCGCATTTCTCACGACGCAGGAAGATGTTTTGGATAAGCCGCGGTGGAGTGACGCG
CCATATCGCATCAGAAACCACACGGGCTTCGTCATCACGATGCACTCGCGCAGCCCAAGCAGCGAGGAGTTCATC
GACCTGCGGCTCGAAGACGGAGAGGAGGCACCGTGGACCTTTGAAGAATGGGAGAAGATGCGAGAGAACATCCTG
ACCGAAGCCGCCGCCCAGAACGACGTGGGCATAAAGTTGGAGGGCAGCGGCTTCGACACTGTCAAGAACGTGCGG
GTGAACCGAGAGGGCGAGTTCCTCTACAGCCTGCGGCCCAAGACGGACAATGTGACGCATCGGCTGTGCGTGGAC
GTACGTCTCGGGTCTGACAATGTCAAGGACGTCACGCTACGGTCTCCGCTGCTTGTCGAGAACGCGACGGAGATC
CCGGTCGAGCTCGGCATCTACGACGCTTCAGAGGGCCACCTTCTCAAGATCGAGAAGATCGCTCCCGGGGATTCG
CGTCCAGCTCCGGTGGGTGCCGCGTTCGAGAAGAGGGTCATTGTGCGTCCGGACAGCGGCTTCGGCTATCAGTGG
AGCAGAGATCAGCTCTGGTGGAGGGATCTGCTCAAGCGACCGACCAAGCAGCTCGTCTGCATTGGGGATACCGGC
GACTCGTTCTACTTTCAGGTCCACGCGGACTTTGACAAGACCAACCCATTGACCAAGGCATACCCCTCGATGAAG
ATCAAGCTCTCGGCTCCGTTGACGCTGGAGAATCTGTTGCCGTACGACTTCAAGTACAGGATCTACGACAGGAAC
ACTAAGAGGGACTGGTCCAACTTTTTGCGAAAGGGCGGCGTGAGCCCCGTCCACATGGTGGAGCTCTCTCACCTC
TTGCTCCTGAGTGTCGATATGCAGGACACCATCTTCAAGCCTAGCGACTTCTCCATCATCAACCCCGGGAGCAAC
GACGACTTCCGGAAGGAGAACCGGCTCGTGGTCAAGGACGAGCAAGGCTTGACGCTGCATCTGAGCCTCCACTAC
TTCAAAGTGCCCAAGAGCGGGGGAGCGTTCAAGATCAGCGTATACAGCCCCTACGTCGTGTTGAACAAGACGGGT
CTCGACATGCGGATCCGCGCCAAGAGCTTCCTACAGCAGGCCAAGGCGGCGGCCGGTCAATTCCCCGTGGTGCAG
ACGGGAAGCCAAGATAGACCGAAGGCGCTGCCGTTCATGTTCTCGTTCGGAAACGACGAGCATCAGAACCGGGTG
CTGCTCAAGGTGGACGAGTCGGAATGGAGCAAGCCGCAGAGCTTCGACGCGGTAGGGAGCACATCGGAAGTGATA
CTGAACTCGTCGACGTCCAAGCATAGGGAGATTCACCTGGGCATCACGGTCAAGTCGGGCGACGGCAAGTACAAG
ATGACGCGGGTCGTGACGCTGGCGCCGCGCTTCGTGCTGGTCAACAAGCTGGGCGAGGAGATTCTGGTGCGCGAG
TCGGGCTCGTCGAACCACATGACCATCAGATCAGGAGTCCTGCATCCGCTACACTTTATGCAAAAGTCGGCGGTC
AAGCAGCTGTGCCTGTGCTTCCCGGGCGTCGACAACCACTGGACGTCGCCCTTTAACATCGCAGACCTCGGGACG
ACGCACGTCAAGATGACCAGGGCCGGACAGCGGCAGCGGCTGGTGCGGCTTGAGATTCTTACAGAGGAGTCGACC
ATCTTCTTGCACATGAGCATCGAGGGCAAGCACTGGCCCTTTTCCATGCGTAACGAGAGCGACACCGAGTTCTCC
TTTTACCAGGCCAACCCCAACGTCGACGAGGACGACGACGAGGACCGAAGCGGATGGAAGCCGGTGCGGTACCGT
CTGCCGCCTCGGAGCGTGATGCCGTACGCCTGGGACTTTCCGGCCGCCAAGTTCCGCGAGGTGGTGATTTCTACC
TGCGGCAAGGAGCGTCACGTCAAGCTGGCCGAGATGGGAAATCAGATCCCCATGAAGTTTACCGGCCCAGGCGGG
CAGCAGAAGATCATCGACATCAACGTGGCTGCCGATGGGCCAATGCAGACGCTCATCCTCAGCAACTTCCGGGCC
AGCAGGAGCATGTTCAAGCCGGCGGCGGTGTCGAGAACCAACACGGGGCCCGAGGCGTTCGAGGTCAAGGACCAG
GGCACTGGGGCTACCATGTTGGCGCAGCTCAAGCTCTCGGGCATCGGCATCTCGCTCATCAACGCGCACCTCAAG
GAGCTGGCGTACGTGACGCTTCGCGAGGTGCAGCTACGGCTCAGCGACTCGCCGCTGATACAAACCATGTCGCTG
GCGGTCAAGTGGATTCAGATCGACAACCAGCTGTACGGCGGCATATTCCCCATAGTGCTGTACCCGAGCGTGGTG
CCCAAGCGGGCCAACGAGGTCGAGGCGCACCCTTCGCTGCACGCCATGGTCAGCCGGGTCAAGGACGACTCGTAC
GGGGTGCTGTACATCAAGTACGCGACGGTGCTGCTGCAGCAGATGACGGTGGACCTGGACGAGGACTTTGTCTTT
GCTCTTCTCGACTTCTCCAACGTTCCGGGCGCCAGCTGGACGGCGGTCGAAGGATCCGGATCGGGCCGGCTGTGC
GACGAAGACCTCGACATCCCCGAGCCGTCGCAGCAGCAGTCCGGGCAGGACATGTACTTTGAGGTGCTCAATATT
CAGCCGATGCAGATCGACCTCAGCTTCGTGCGGACGGAGCGAGTCAATGCCGAGGATAAGACGTCGACGCGGAAC
CCCATCATGTTCTTCCTCAACGTCATGACCATGGCCATTGGCAACGTCAACGACGCACCTGTTCGCTTCAACGCG
CTGATGCTGGACAATGTGAGGGTGTCGCAGGCGGTGCTGGTGCAGAACGTGTCGAGCCACTACAGCCAAGAGGTC
ATGTATCAGATCCACAAGATCCTGGGCTCGGCCGACTTTCTGGGCAACCCGGTCGGCCTGTTCAACAACATCTCG
TCGGGCGTGACGGACATCTTTTACGAGCCGTACCAGGGGCTCATCCTCTCGGACCGACCCGAGGAGTTTGGCATC
GGTATCGCGCGCGGAGCCGTTTCGTTTGCCAAGAAGACGGTCTACGGCTTCAGCGACAGCTTCTCCAAGTTTACG
GGCAGCCTGGGCAAGGGCCTGGCGGCGGCATCGCTGGACAAGCAGTTCCAGGACCGGCGGCGAATTACGAGGGCT
CGCAACCGGCCCAAACACGCGCTGTACGGGGTGGCGGCGGGTGCCAACTCGCTGCTGACGAGCGTGGCTTCGGGA
GTCGGGGGCCTGGCGCGCAAGCCGCTCGAGGGGGCGGAGCAGGAGGGCGCCCTGGGCTTCTTCAAGGGCGTGGGC
AAGGGCGTGCTCGGGCTGGCGACGAAGCCGGCGGTCGGGGTGCTGGACATGGCGAGCAACGTCAGCGAGGGCATC
CGCAACACGACGACGGTCTTTGACGGATCGGAGCTGGAGCGGACGCGGCTGCCGCGGTTCATGGCCAACGACGGC
ATCGTGAGGCCGTACGGGGCGCGAGAGGCTCTGGGCCAGTTCTGGCTGAAGCAGGTCGACAACGGCAAGTACTTT
GACGAGCAGTACGTCGGCCACCTGGAGCTGCCTCGCGAGGACATGGTGGTCATGGTGACGTTCGCGCGCATCCTG
CTGATTCGGTCTCGGCGCCTGACGAGCGAGTGGGACGTCAAGCTCAAGGACGTGCAGACGGTGGCCAAGGAGAGG
ACGGGCGTGAGCCTGACGCTGCGGGGGGGCACCAACGGGCCGTTCATCCCGGTGGGCGGCGGCAGCGAGCGGGGA
TACCTGTACCGGATGATTGGGGTGGCGGCCGAGGAATTCAATCGGCGTTTCCGGGGCGCCGAGTGA
Transcript >Ophun1|2027
ATGGAGCAGGCGGCCGTCGAGACAAGACCCACCGACTATCGGCTTCCCGAGTGGTCTCCCGGGGCTCTGCAGCGA
CCAGGAACCGAGACAGCGGTGCAGAGCCCCAATTCACACGCTCCGAACCCCTTTCCCGGCCCGGGTCACGGCATC
CCGGCCTTCGCCATGCTCGAGGGGCTCGCGGCCGGACTGCTCAACCGCTTCTTGGGCATGTACGTCCAGAACTTC
GATCCCACCCAGCTCAAGGTCGGCATCTGGTCTGGCGACGTCAAGCTCCGCAACCTCGAGCTCCGGCGCGAGGCC
CTCGATCAGCTCAAGCTGCCCATCAACGTCGTCGAGGGCCATCTCGGCGAGCTGACGCTCATAATCCCGTGGTCC
AACCTTCGAGGCGCCCCGGTCAAGGTCTTCGTCGAGGACGTCTTCCTGCTCGCCAGTCCAAAGGAAGAGGCCGAA
TATGACCAGAAGGAGGAGGAGCAACGGAGCCAGCGGCTCAAGATGGAGAAGCTCGACAGCGCCGAGCTGCTCAAG
GAGAAGAATCGAGAGGGCATGAGTCCTGAGGAGCAGCAAAAGAACCAGAGCTTCACGCAGAGTCTCGTCACAAAG
ATTGTCGACAACCTGCAAATCACCGTCAAGAACATCCATATCCGATACGAAGATTCCATCTCCGCCCCCGGCCAT
CCCTTTGCCCTCGGCCTCACGCTCGAACAGTTCTCGGCTGTCAGCACCGACGGCGACTGGAAGCCGACTTTTATA
CAAAACTCGACCGTCATCACCAATAAGCTGGCCACGCTCGGAGCCCTGGCCGTTTACTGGAACACAGACACTGAT
CTCATGGGCAGTGGGCGCGAAGCTGCGCTGCCGCCTGACGAGGCCATGTCCCATGAAGACATGGTGACCAAGTTT
CGCTCCCTCATCGACACGACCGCCTCTTCGGATCATCAGTTCATTCTGAAGCCCGTCAGCGGCCAGGCCAAGATC
GAGCTCAACAAGTCGGGCGATGTTGTCGCCCCCAAGTTCAAGGTCAACCTGCTGTTCGAGGAGATCGGTCTCGTG
CTCGACGACCACCAATACCGCGATGCCCTGATGATGGCCGATCTGTTCCACTACTTCATCCGCCATCAGGAGTAC
CGAGCGCTGAAGCCCAAGGGCGTTCGACCGGACCAGGATCCCCGAGCTTGGTTTAAATTCGCAGGCAACGCCGTG
CTCGGCAACATCCACGAGCGAAACCGCAAGTGGTCCTGGGACTATTTCAGGGAGCGGCGCGACGATCGCATCCGC
TACATCGAACTCTTCAAGAAGAAAAAGGAGCAGCAACAGCTGTCGCCGGACGAAGAAGAGGATATCGTGACTCTG
GAGTGGAAGCTGGGATATGAAGACTTGCGCTTCTGGCGGTCCCTGGCCCGGAACCAGCTCAAAAAGGAAAACGCG
GAGGCTTTGAAAAGACGAGCCCAGCAGCCCGAGCAGCAGGGCTGGATGTCATGGATCTGGGGCTCGAAGCCCCAG
GGAAAGATTGAGAAGAACGAGGAGAACACTCAGATGACCGAGGAGCAGCGCAAGGAGCTGTACGACATGATCGAC
TGGGACGAGAAGACGGCCCTGGCGGAGGCCATCGACGTGCCGCGTGAGGCCGTCAAGCTCTGCATCGAGGCCTGT
CTCGGCACCGGGAGCTTCACCCTCAGACAGGGCAGCCACGGAAAAGCCCCGAGAGACCTGCTTGGGTTATACTTT
GACGTCTTCAAAGCAAAGGCTCTACAGCGCAAGGACTCGCTGCTCGCAAACGTCAGTCTCGGAGGGTTGCGGGTC
GAGGACGGCACGACACCAGACAGCCTGTACCCCGAGATTGTACGGGTCAAAGACGCTCCCGGAACGAAGCAGCGC
AAGAGACTATCCCTAGCGGAGCTAGAGAAGAGCAGCGATGAGCCGTTCTTTCAGTTCGAGGTGGAGCAGAACCCG
ATCGAGCGCGAGGGCGACATCGCCGTCATGGGCAGTCTGAAGCCCCTCGAGGTCGTGTGGAATCCCAACTTCGTC
GTTGGAATCGTGGACTTTTTCAGACCGCCCGAGAGGCACATGGAGTCCATCACGGCCCTCATGGAGACGGCCGGC
GCCACCGTCGAGGGCATCAGGGAGCAGACGCGCGCCGGCCTCGAGTTCGCCCTCGAGGAGCACAAGACCATCAAC
GCCGAGCTGAGCCTGCAGGCACCGCTCATCATCGTGCCCGTGAGCATCACCGCCAGGGAGTCTACGTGTGTCATC
GTCGACGCCGGCCACATTCACGTCAACAGCCAGCTGGTCGACCAGGACACCATGAAGGAAATTCAGGCCAAGCAG
CGGCAGACTTACAGCGAGGAGGATTTCAAGCGGCTCGAGTCGGTCATGTACGACAAATTCATCGTCAAGCTCACC
TCTACCCAGGTCCTCATCGGACCTTCGATCGAGAAGACCAAGGCGGAGCTCATAAGGAGAAGCGAAGGCTCCCAG
CTGCACGTCGTCGAGAAGATCAACGTCGACTTTGTCGTGGAGACGTCGATCCTGCCCAAGGCCCCCAATCTGACC
AAGTTCAGGGTTTCCGGCCATATGCCCATGCTCCACGCCTCGGTGTCTGACTCCAAGTACAAGAACCTAATGAAG
ATCATCGATGTGGCCATTCCCAAGCTCGGAGGCGAGAGTCAGCAGGACGAGGCGCCGGCGTCCAAGACCGACGAG
GGCGGGCATCCCCGAGCTACGACGCCGCAACAGCAGACACGACAGCCTTCGCGACCCCGGCTTGCAAGCAGCGGC
TCGAATAAGTCTCCTCGGCGAAAGTCCCAGCGGGAGAATCGGCAGTCGGCTGGTTTCCCCTTTCTGCAGCCGCCC
AGCGCCGTCGTGCTGGACGACATGGACGATGACCAGGACGACTTCGAGGACGCCTCAGACGGTGCAGACGGACAG
CAGCTCAAGATTCAGCAGCGGAGCTTCGAGTTCAACTTCAAGGTCGATACTCTCAAAGGCTCGCTCTACCGCAGC
GATCCGGACTGCATCAAGCCCGACGCTCTGTTGGTCGAGCTCGTGGCTGAGCGTTTCGACCTTGCCTTTTACACG
AGGCTGTACGATATGTCTGCAGAGGTATCTCTCGGGGCTGTGTCTGTGGACGACTTCGTCGACAATCCTCCTGCA
GAGTTCAAGTCCATCGTCTCGTCCGGTGACAGTGATGACCTCCAGGAAGGACGGAGTCTGGTTCACGTCAAGTAC
ATGGATGTCAAGCCACAGTCTCCCGAGTTTATGCCCGTTTACGAGGGAGTCAAGACGAACATCAGTGCTTCGGTG
TCGACCATCAACCTCGTCGTGACGAGGAAGACGCTACTGACGCTCCTCGACTTCATTCTCGTCACCTTTGCGGGA
GGCAACAACGACCAGGAACAGAGCCGAACGGTCATTACCGATGGTCAAGAAACCGGGTACGAAGAGACGGCTACG
GAGCCGGCTAAGCAAAATGTCGACTCTGGTTCCATCAGAGTCAAGGTGGATCTGAAGGGCATCAGGCTCATCCTC
AACAACGATGGCATAAGGTTGGCGACGCTTTCGCTCACGGAGGCCGACGCCGGCATATTCCTGCGCGGAAATACG
ATGCGAATATTTGCAAAACTCGGAGATTTGTCTCTCGTCGACGACGTCAACCTGGGCGTCTCCAGCGACTCCAAC
CTGCGGAGGCTCGTCACCATCCAGGGCGACGAGCTCGCCGATTTCCGCTACGAGACGTTTGACGCGGATAACAAG
CACGCTTATCCGGGCCATGACAGCGCCATCTTCCTGCGAGCTGGTTCGGTCAAGGTGAACTTTGTCGAGGAGCCG
TTCCGCAAGATCATCGACTTCCTCGTCAAGTTTGGCAGGATGCAAGCCCTCTACAACGCTGCTCGACAGGCCGCC
GTCACACGGGCCAACCAGATGCAGCAGAGTCCCAGCAGGTTCAAGTTTGACGTGGTGATCAAGACGCCCATCGTC
GTCTTCCCCCGCTTGATGGTTTCGGAGTCTCCCGAGCGCGACGTCGTGACGGCATACCTGGGTGAGATCTATGCG
CAGAATGAGTTTGCGCCGCTCGACGACGCCGAGGACTCTCGGATCGCCATGAAAATATCCACGGGCATCAGGAAG
ATCCGGCTTACGTCCGACTTTTACTACGACAATGACAGATCGGAAGAGCTGGAGATGATAGATCAGGTCGACCTT
GGGCTCAGCATCACCTACGCTGAGCACAAGCCTGGCGCCATGCGTCCAGACACGGAGATTGAGGCGTCCATGTCG
GACATCAAGCTCAGACTCACGCAGCATCAGCTCAAGTTCCTGCTGGAGATCTCCAAAGCAGTTCCCGCTGCGTTT
GCTGGCGACGGCAGCACCGGCGACGAGGAAGCGGCTCAGCTCGTCGACGAGGAGACGCTGCGGCGTGCTAGAACC
GCGTCGGCAGACGATGGTATCAGCCCTGACCAGCACGCCGTCGACCTCGGCCCCGAGTTGAAGTCGCCTACGGAT
ACTTGGACTCAGCTCGACTTGATATTCCGAGTCGACACCATCGGTCTCGAACTCATCAGGGCCCCGCTGGACGAG
CCCGTGGGCGACTTGGCCGCTTCCAGCCTGTCTCGCTTCTCGCTTGACGAAACCAAGGTCAAGACGCGGATGATG
TCGGATGGCTCGTTGGAAGCCGAGCTGCTCATTCGTTCCTTGACCATCTACGATAGCCGTCCGAAAGGGGTCAAC
AAGTTCCGTCGCATCATGAGCTCGTCAAACAAAGAGTCGCAGCAACTCATGGCGAGCGTCACCATGTCGGGCGGC
AAGGAGCGTAGCATGATTGCCATGGCGACCATTGACAGCCCTCGCGTCATCTTCGCACTCGACTACCTCTTCGCT
ATCCAGGCGTTTGCCGCCGAAGGCCTCAAGGTGGAAGATTCCAGCCCACTGGACGATATCAGCACCGACGAGTCG
CCAGAAAGCTCGGAAGATGCAGACTCGGTGCGAGTGTCGTCCACTAAACCTGGTCGATCGCAGGTGACGTCTCCG
CGACGCAGCGAATCGAGCTCCAGCGAGCTGCAGAAGCGTCAAGGCGAGGCTTCGATGAGCTTGGCCTTGCGAATC
AACCTCGTTGACGCGCAGGTCATACTCATCGCCAACCCGCTGCGGTCCAATTCCGAAGCCATCGTACTGGGCATT
CGACAGGTGCTTCTATCGCAACAGAACGCACTCACCTTCCAGGTCTCCGAGATGGGCATGTTTCTCTGTGCCATG
GACAGGTTCGAGACGTCGCGCCTCAGAATCATCGACGACTTTTCGATCCAGTTGAACATGGACAGCTCGCAGCCA
TTCATGACCAGCTATCACGTAGATGTCGAGCCTCTCATCGTCCGACTCTCCCTGAGAGACATTCTCCTCGTGCTC
CAGATTGTCGCCAAAGCCGGCGAGCTATCGGAAAGCGGGAAAGAGCCGGTCAAAGAGACGCCAGCGGAGCACAAG
GTGAAGCAACTCAGGGGCGCCAGCACCAAGTCAAAGGCCCCCAGCGGCCGCGCTCTGTCGACAGCGGCTCAGACC
AAAGCCAACCAGGCCGTTGTCGCCAAAGGTGCCGCGGCGACCAAGGCACGCGGCAGAACCACGCATGAGGAGCTC
TCTGCGACGCTTCAGGGCATGCGAGTCGTGCTGATCGGAGACCTGCACGAGCTGCCCATTATCGACGTCGGAGTC
AAGGAGTTTACGGCGACGGCAGAGAATTGGTCGTCGAATCTGAAAGCCGAGGCGGCCATACACACGTACACGAAC
GTCTACAACTTTTCGAAATCCAGCTGGGAGCCCCTGATCGAACCATGGCAAGTCGGCCTGGGCGTGGCCAGAGAC
TCGACTACGGGCGTGCTGTCGGTCGACGTGGCCTCGGCAAAGACGCTCGATATCACAGTCACGACGGCGACCATC
GCATTGGCTTCCAAGTCGCTCGCATTTCTCACGACGCAGGAAGATGTTTTGGATAAGCCGCGGTGGAGTGACGCG
CCATATCGCATCAGAAACCACACGGGCTTCGTCATCACGATGCACTCGCGCAGCCCAAGCAGCGAGGAGTTCATC
GACCTGCGGCTCGAAGACGGAGAGGAGGCACCGTGGACCTTTGAAGAATGGGAGAAGATGCGAGAGAACATCCTG
ACCGAAGCCGCCGCCCAGAACGACGTGGGCATAAAGTTGGAGGGCAGCGGCTTCGACACTGTCAAGAACGTGCGG
GTGAACCGAGAGGGCGAGTTCCTCTACAGCCTGCGGCCCAAGACGGACAATGTGACGCATCGGCTGTGCGTGGAC
GTACGTCTCGGGTCTGACAATGTCAAGGACGTCACGCTACGGTCTCCGCTGCTTGTCGAGAACGCGACGGAGATC
CCGGTCGAGCTCGGCATCTACGACGCTTCAGAGGGCCACCTTCTCAAGATCGAGAAGATCGCTCCCGGGGATTCG
CGTCCAGCTCCGGTGGGTGCCGCGTTCGAGAAGAGGGTCATTGTGCGTCCGGACAGCGGCTTCGGCTATCAGTGG
AGCAGAGATCAGCTCTGGTGGAGGGATCTGCTCAAGCGACCGACCAAGCAGCTCGTCTGCATTGGGGATACCGGC
GACTCGTTCTACTTTCAGGTCCACGCGGACTTTGACAAGACCAACCCATTGACCAAGGCATACCCCTCGATGAAG
ATCAAGCTCTCGGCTCCGTTGACGCTGGAGAATCTGTTGCCGTACGACTTCAAGTACAGGATCTACGACAGGAAC
ACTAAGAGGGACTGGTCCAACTTTTTGCGAAAGGGCGGCGTGAGCCCCGTCCACATGGTGGAGCTCTCTCACCTC
TTGCTCCTGAGTGTCGATATGCAGGACACCATCTTCAAGCCTAGCGACTTCTCCATCATCAACCCCGGGAGCAAC
GACGACTTCCGGAAGGAGAACCGGCTCGTGGTCAAGGACGAGCAAGGCTTGACGCTGCATCTGAGCCTCCACTAC
TTCAAAGTGCCCAAGAGCGGGGGAGCGTTCAAGATCAGCGTATACAGCCCCTACGTCGTGTTGAACAAGACGGGT
CTCGACATGCGGATCCGCGCCAAGAGCTTCCTACAGCAGGCCAAGGCGGCGGCCGGTCAATTCCCCGTGGTGCAG
ACGGGAAGCCAAGATAGACCGAAGGCGCTGCCGTTCATGTTCTCGTTCGGAAACGACGAGCATCAGAACCGGGTG
CTGCTCAAGGTGGACGAGTCGGAATGGAGCAAGCCGCAGAGCTTCGACGCGGTAGGGAGCACATCGGAAGTGATA
CTGAACTCGTCGACGTCCAAGCATAGGGAGATTCACCTGGGCATCACGGTCAAGTCGGGCGACGGCAAGTACAAG
ATGACGCGGGTCGTGACGCTGGCGCCGCGCTTCGTGCTGGTCAACAAGCTGGGCGAGGAGATTCTGGTGCGCGAG
TCGGGCTCGTCGAACCACATGACCATCAGATCAGGAGTCCTGCATCCGCTACACTTTATGCAAAAGTCGGCGGTC
AAGCAGCTGTGCCTGTGCTTCCCGGGCGTCGACAACCACTGGACGTCGCCCTTTAACATCGCAGACCTCGGGACG
ACGCACGTCAAGATGACCAGGGCCGGACAGCGGCAGCGGCTGGTGCGGCTTGAGATTCTTACAGAGGAGTCGACC
ATCTTCTTGCACATGAGCATCGAGGGCAAGCACTGGCCCTTTTCCATGCGTAACGAGAGCGACACCGAGTTCTCC
TTTTACCAGGCCAACCCCAACGTCGACGAGGACGACGACGAGGACCGAAGCGGATGGAAGCCGGTGCGGTACCGT
CTGCCGCCTCGGAGCGTGATGCCGTACGCCTGGGACTTTCCGGCCGCCAAGTTCCGCGAGGTGGTGATTTCTACC
TGCGGCAAGGAGCGTCACGTCAAGCTGGCCGAGATGGGAAATCAGATCCCCATGAAGTTTACCGGCCCAGGCGGG
CAGCAGAAGATCATCGACATCAACGTGGCTGCCGATGGGCCAATGCAGACGCTCATCCTCAGCAACTTCCGGGCC
AGCAGGAGCATGTTCAAGCCGGCGGCGGTGTCGAGAACCAACACGGGGCCCGAGGCGTTCGAGGTCAAGGACCAG
GGCACTGGGGCTACCATGTTGGCGCAGCTCAAGCTCTCGGGCATCGGCATCTCGCTCATCAACGCGCACCTCAAG
GAGCTGGCGTACGTGACGCTTCGCGAGGTGCAGCTACGGCTCAGCGACTCGCCGCTGATACAAACCATGTCGCTG
GCGGTCAAGTGGATTCAGATCGACAACCAGCTGTACGGCGGCATATTCCCCATAGTGCTGTACCCGAGCGTGGTG
CCCAAGCGGGCCAACGAGGTCGAGGCGCACCCTTCGCTGCACGCCATGGTCAGCCGGGTCAAGGACGACTCGTAC
GGGGTGCTGTACATCAAGTACGCGACGGTGCTGCTGCAGCAGATGACGGTGGACCTGGACGAGGACTTTGTCTTT
GCTCTTCTCGACTTCTCCAACGTTCCGGGCGCCAGCTGGACGGCGGTCGAAGGATCCGGATCGGGCCGGCTGTGC
GACGAAGACCTCGACATCCCCGAGCCGTCGCAGCAGCAGTCCGGGCAGGACATGTACTTTGAGGTGCTCAATATT
CAGCCGATGCAGATCGACCTCAGCTTCGTGCGGACGGAGCGAGTCAATGCCGAGGATAAGACGTCGACGCGGAAC
CCCATCATGTTCTTCCTCAACGTCATGACCATGGCCATTGGCAACGTCAACGACGCACCTGTTCGCTTCAACGCG
CTGATGCTGGACAATGTGAGGGTGTCGCAGGCGGTGCTGGTGCAGAACGTGTCGAGCCACTACAGCCAAGAGGTC
ATGTATCAGATCCACAAGATCCTGGGCTCGGCCGACTTTCTGGGCAACCCGGTCGGCCTGTTCAACAACATCTCG
TCGGGCGTGACGGACATCTTTTACGAGCCGTACCAGGGGCTCATCCTCTCGGACCGACCCGAGGAGTTTGGCATC
GGTATCGCGCGCGGAGCCGTTTCGTTTGCCAAGAAGACGGTCTACGGCTTCAGCGACAGCTTCTCCAAGTTTACG
GGCAGCCTGGGCAAGGGCCTGGCGGCGGCATCGCTGGACAAGCAGTTCCAGGACCGGCGGCGAATTACGAGGGCT
CGCAACCGGCCCAAACACGCGCTGTACGGGGTGGCGGCGGGTGCCAACTCGCTGCTGACGAGCGTGGCTTCGGGA
GTCGGGGGCCTGGCGCGCAAGCCGCTCGAGGGGGCGGAGCAGGAGGGCGCCCTGGGCTTCTTCAAGGGCGTGGGC
AAGGGCGTGCTCGGGCTGGCGACGAAGCCGGCGGTCGGGGTGCTGGACATGGCGAGCAACGTCAGCGAGGGCATC
CGCAACACGACGACGGTCTTTGACGGATCGGAGCTGGAGCGGACGCGGCTGCCGCGGTTCATGGCCAACGACGGC
ATCGTGAGGCCGTACGGGGCGCGAGAGGCTCTGGGCCAGTTCTGGCTGAAGCAGGTCGACAACGGCAAGTACTTT
GACGAGCAGTACGTCGGCCACCTGGAGCTGCCTCGCGAGGACATGGTGGTCATGGTGACGTTCGCGCGCATCCTG
CTGATTCGGTCTCGGCGCCTGACGAGCGAGTGGGACGTCAAGCTCAAGGACGTGCAGACGGTGGCCAAGGAGAGG
ACGGGCGTGAGCCTGACGCTGCGGGGGGGCACCAACGGGCCGTTCATCCCGGTGGGCGGCGGCAGCGAGCGGGGA
TACCTGTACCGGATGATTGGGGTGGCGGCCGAGGAATTCAATCGGCGTTTCCGGGGCGCCGAGTGA
Gene >Ophun1|2027
ATGGAGCAGGCGGCCGTCGAGACAAGACCCACCGACTATCGGCTTCCCGAGTGGTCTCCCGGGGCTCTGCAGCGA
CCAGGAACCGAGACAGGTGTGTATTAATGGCAGACGCGAGGTTGCGATGCGTGACGATTGGGGCGCGGTGTGACG
GACGGAGTGACGTCATGAGGCTGGTGGGAAAGCTGTCGTCACTGTCAGCAATCGAGGAGGGGTGAGAACCTGCCC
GAGCTAATGGATGTAGAGACGCGCCAGCCATCCATCAAAAAACTTGAAATTTCCCAAGACTCGTGAGTGAGGTCA
ATGGGAGTTTGATAGAATGTGCACGCAGAGAGCTGCTGCATAAAGAAAGGAATAATAAATAAGAGAATAAGAGCG
AGGCAGATGGATCGCTCGTATCGCCCCCTCGCATTGCGCCCGAATCTCAGCCAGCACATGTTAGCGCATTGCGCC
CGCTGAGTCTCCGCGGTACAGCGGTGCAGGTACTGGAACCTGCGTCAGCGGGCACCTCTGTCATCAGTGCGGGCA
TCACCTTGCAGTGCGGGCAGCAGCGGGCTGGATCCTGGATGGAAACCGGCTGAGAGCGAGCGCCTTGGAATCATC
CATGTTTGGAGTCGCAGCGTCGCCGTCACCTCGTCTCTACTCTGTCTTCCCTTCCATCTCCAGCTCCCCGACAGC
ATCGCCTGGCATCCCTCCGCCGCCATCCTCGTCGCTGGATTCGAACCCCGCTGACAGCATCCATCATCGCCAACG
ACACATCGGCTTTCTCTCTCACATCGTCCGACTGGCCGTCCCTCGACGAGCCGTCTGCAAATGCTGCTCCTCTAG
AGCCCCAATTCACACGCTCCGAACCCCTTTCCCGGCCCGGGTCACGGCATCCCGGCCTTCGCCATGCTCGAGGGG
CTCGCGGCCGGACTGCTCAACCGCTTCTTGGGCATGTACGTCCAGAACTTCGATCCCACCCAGCTCAAGGTCGGC
ATCTGGTCTGGCGACGTCAAGCTCCGCAACCTCGAGCTCCGGCGCGAGGCCCTCGATCAGCTCAAGCTGCCCATC
AACGTCGTCGAGGGCCATCTCGGCGAGCTGACGCTCATAATCCCGTGGTCCAACCTTCGAGGCGCCCCGGTCAAG
GTCTTCGTCGAGGACGTCTTCCTGCTCGCCAGTCCAAAGGAAGAGGCCGAATATGACCAGAAGGAGGAGGAGCAA
CGGAGCCAGCGGCTCAAGATGGAGAAGCTCGACAGCGCCGAGCTGCTCAAGGAGAAGAATCGAGAGGGCATGAGT
CCTGAGGAGCAGCAAAAGAACCAGAGCTTCACGCAGAGTCTCGTCACAAAGATTGTCGACAACCTGCAAATCACC
GTCAAGAACATCCATATCCGATACGAAGATTCCATCTCCGCCCCCGGCCATCCCTTTGCCCTCGGCCTCACGCTC
GAACAGTTCTCGGCTGTCAGCACCGACGGCGACTGGAAGCCGACTTTTATACAAAACTCGACCGTCATCACCAAT
AAGCTGGCCACGCTCGGAGCCCTGGCCGTTTACTGGAACACAGACACTGATCTCATGGGCAGTGGGCGCGAAGCT
GCGCTGCCGCCTGACGAGGCCATGTCCCATGAAGACATGGTGACCAAGTTTCGCTCCCTCATCGACACGACCGCC
TCTTCGGATCATCAGTTCATTCTGAAGCCCGTCAGCGGCCAGGCCAAGATCGAGCTCAACAAGTCGGGCGATGTT
GTCGCCCCCAAGTTCAAGGTCAACCTGCTGTTCGAGGAGATCGGTCTCGTGCTCGACGACCACCAATACCGCGAT
GCCCTGATGATGGCCGATCTGTTCCACTACTTCATCCGCCATCAGGAGTACCGAGCGCTGAAGCCCAAGGGCGTT
CGACCGGACCAGGATCCCCGAGCTTGGTTTAAATTCGCAGGCAACGCCGTGCTCGGCAACATCCACGAGCGAAAC
CGCAAGTGGTCCTGGGACTATTTCAGGGAGCGGCGCGACGATCGCATCCGCTACATCGAACTCTTCAAGAAGAAA
AAGGAGCAGCAACAGCTGTCGCCGGACGAAGAAGAGGATATCGTGACTCTGGAGTGGAAGCTGGGATATGAAGAC
TTGCGCTTCTGGCGGTCCCTGGCCCGGAACCAGCTCAAAAAGGAAAACGCGGAGGCTTTGAAAAGACGAGCCCAG
CAGCCCGAGCAGCAGGGCTGGATGTCATGGATCTGGGGCTCGAAGCCCCAGGGAAAGATTGAGAAGAACGAGGAG
AACACTCAGATGACCGAGGAGCAGCGCAAGGAGCTGTACGACATGATCGACTGGGACGAGAAGACGGCCCTGGCG
GAGGCCATCGACGTGCCGCGTGAGGCCGTCAAGCTCTGCATCGAGGCCTGTCTCGGCACCGGGAGCTTCACCCTC
AGACAGGGCAGCCACGGAAAAGCCCCGAGAGACCTGCTTGGGTTATACTTTGACGTCTTCAAAGCAAAGGCTCTA
CAGCGCAAGGACTCGCTGCTCGCAAACGTCAGTCTCGGAGGGTTGCGGGTCGAGGACGGCACGACACCAGACAGC
CTGTACCCCGAGATTGTACGGGTCAAAGACGCTCCCGGAACGAAGCAGCGCAAGAGACTATCCCTAGCGGAGCTA
GAGAAGAGCAGCGATGAGCCGTTCTTTCAGTTCGAGGTGGAGCAGAACCCGATCGAGCGCGAGGGCGACATCGCC
GTCATGGGCAGTCTGAAGCCCCTCGAGGTCGTGTGGAATCCCAACTTCGTCGTTGGAATCGTGGACTTTTTCAGA
CCGCCCGAGAGGCACATGGAGTCCATCACGGCCCTCATGGAGACGGCCGGCGCCACCGTCGAGGGCATCAGGGAG
CAGACGCGCGCCGGCCTCGAGTTCGCCCTCGAGGAGCACAAGACCATCAACGCCGAGCTGAGCCTGCAGGCACCG
CTCATCATCGTGCCCGTGAGCATCACCGCCAGGGAGTCTACGTGTGTCATCGTCGACGCCGGCCACATTCACGTC
AACAGCCAGCTGGTCGACCAGGACACCATGAAGGAAATTCAGGCCAAGCAGCGGCAGACTTACAGCGAGGAGGAT
TTCAAGCGGCTCGAGTCGGTCATGTACGACAAATTCATCGTCAAGCTCACCTCTACCCAGGTCCTCATCGGACCT
TCGATCGAGAAGACCAAGGCGGAGCTCATAAGGAGAAGCGAAGGCTCCCAGCTGCACGTCGTCGAGAAGATCAAC
GTCGACTTTGTCGTGGAGACGTCGATCCTGCCCAAGGCCCCCAATCTGACCAAGTTCAGGGTTTCCGGCCATATG
CCCATGCTCCACGCCTCGGTGTCTGACTCCAAGTACAAGAACCTAATGAAGATCATCGATGTGGCCATTCCCAAG
CTCGGAGGCGAGAGTCAGCAGGACGAGGCGCCGGCGTCCAAGACCGACGAGGGCGGGCATCCCCGAGCTACGACG
CCGCAACAGCAGACACGACAGCCTTCGCGACCCCGGCTTGCAAGCAGCGGCTCGAATAAGTCTCCTCGGCGAAAG
TCCCAGCGGGAGAATCGGCAGTCGGCTGGTTTCCCCTTTCTGCAGCCGCCCAGCGCCGTCGTGCTGGACGACATG
GACGATGACCAGGACGACTTCGAGGACGCCTCAGACGGTGCAGACGGACAGCAGCTCAAGATTCAGCAGCGGAGC
TTCGAGTTCAACTTCAAGGTCGATACTCTCAAAGGCTCGCTCTACCGCAGCGATCCGGACTGCATCAAGCCCGAC
GCTCTGTTGGTCGAGCTCGTGGCTGAGCGTTTCGACCTTGCCTTTTACACGAGGCTGTACGATATGTCTGCAGAG
GTATCTCTCGGGGCTGTGTCTGTGGACGACTTCGTCGACAATCCTCCTGCAGAGTTCAAGTCCATCGTCTCGTCC
GGTGACAGTGATGACCTCCAGGAAGGACGGAGTCTGGTTCACGTCAAGTACATGGATGTCAAGCCACAGTCTCCC
GAGTTTATGCCCGTTTACGAGGGAGTCAAGACGAACATCAGTGCTTCGGTGTCGACCATCAACCTCGTCGTGACG
AGGAAGACGCTACTGACGCTCCTCGACTTCATTCTCGTCACCTTTGCGGGAGGCAACAACGACCAGGAACAGAGC
CGAACGGTCATTACCGATGGTCAAGAAACCGGGTACGAAGAGACGGCTACGGAGCCGGCTAAGCAAAATGTCGAC
TCTGGTTCCATCAGAGTCAAGGTGGATCTGAAGGGCATCAGGCTCATCCTCAACAACGATGGCATAAGGTTGGCG
ACGCTTTCGCTCACGGAGGCCGACGCCGGCATATTCCTGCGCGGAAATACGATGCGAATATTTGCAAAACTCGGA
GATTTGTCTCTCGTCGACGACGTCAACCTGGGCGTCTCCAGCGACTCCAACCTGCGGAGGCTCGTCACCATCCAG
GGCGACGAGCTCGCCGATTTCCGCTACGAGACGTTTGACGCGGATAACAAGCACGCTTATCCGGGCCATGACAGC
GCCATCTTCCTGCGAGCTGGTTCGGTCAAGGTGAACTTTGTCGAGGAGCCGTTCCGCAAGATCATCGACTTCCTC
GTCAAGTTTGGCAGGATGCAAGCCCTCTACAACGCTGCTCGACAGGCCGCCGTCACACGGGCCAACCAGATGCAG
CAGAGTCCCAGCAGGTTCAAGTTTGACGTGGTGATCAAGACGCCCATCGTCGTCTTCCCCCGCTTGATGGTTTCG
GAGTCTCCCGAGCGCGACGTCGTGACGGCATACCTGGGTGAGATCTATGCGCAGAATGAGTTTGCGCCGCTCGAC
GACGCCGAGGACTCTCGGATCGCCATGAAAATATCCACGGGCATCAGGAAGATCCGGCTTACGTCCGACTTTTAC
TACGACAATGACAGATCGGAAGAGCTGGAGATGATAGATCAGGTCGACCTTGGGCTCAGCATCACCTACGCTGAG
CACAAGCCTGGCGCCATGCGTCCAGACACGGAGATTGAGGCGTCCATGTCGGACATCAAGCTCAGACTCACGCAG
CATCAGCTCAAGTTCCTGCTGGAGATCTCCAAAGCAGTTCCCGCTGCGTTTGCTGGCGACGGCAGCACCGGCGAC
GAGGAAGCGGCTCAGCTCGTCGACGAGGAGACGCTGCGGCGTGCTAGAACCGCGTCGGCAGACGATGGTATCAGC
CCTGACCAGCACGCCGTCGACCTCGGCCCCGAGTTGAAGTCGCCTACGGATACTTGGACTCAGCTCGACTTGATA
TTCCGAGTCGACACCATCGGTCTCGAACTCATCAGGGCCCCGCTGGACGAGCCCGTGGGCGACTTGGCCGCTTCC
AGCCTGTCTCGCTTCTCGCTTGACGAAACCAAGGTCAAGACGCGGATGATGTCGGATGGCTCGTTGGAAGCCGAG
CTGCTCATTCGTTCCTTGACCATCTACGATAGCCGTCCGAAAGGGGTCAACAAGTTCCGTCGCATCATGAGCTCG
TCAAACAAAGAGTCGCAGCAACTCATGGCGAGCGTCACCATGTCGGGCGGCAAGGAGCGTAGCATGATTGCCATG
GCGACCATTGACAGCCCTCGCGTCATCTTCGCACTCGACTACCTCTTCGCTATCCAGGCGTTTGCCGCCGAAGGC
CTCAAGGTGGAAGATTCCAGCCCACTGGACGATATCAGCACCGACGAGTCGCCAGAAAGCTCGGAAGATGCAGAC
TCGGTGCGAGTGTCGTCCACTAAACCTGGTCGATCGCAGGTGACGTCTCCGCGACGCAGCGAATCGAGCTCCAGC
GAGCTGCAGAAGCGTCAAGGCGAGGCTTCGATGAGCTTGGCCTTGCGAATCAACCTCGTTGACGCGCAGGTCATA
CTCATCGCCAACCCGCTGCGGTCCAATTCCGAAGCCATCGTACTGGGCATTCGACAGGTGCTTCTATCGCAACAG
AACGCACTCACCTTCCAGGTCTCCGAGATGGGCATGTTTCTCTGTGCCATGGACAGGTTCGAGACGTCGCGCCTC
AGAATCATCGACGACTTTTCGATCCAGTTGAACATGGACAGCTCGCAGCCATTCATGACCAGCTATCACGTAGAT
GTCGAGCCTCTCATCGTCCGACTCTCCCTGAGAGACATTCTCCTCGTGCTCCAGATTGTCGCCAAAGCCGGCGAG
CTATCGGAAAGCGGGAAAGAGCCGGTCAAAGAGACGCCAGCGGAGCACAAGGTGAAGCAACTCAGGGGCGCCAGC
ACCAAGTCAAAGGCCCCCAGCGGCCGCGCTCTGTCGACAGCGGCTCAGACCAAAGCCAACCAGGCCGTTGTCGCC
AAAGGTGCCGCGGCGACCAAGGCACGCGGCAGAACCACGCATGAGGAGCTCTCTGCGACGCTTCAGGGCATGCGA
GTCGTGCTGATCGGAGACCTGCACGAGCTGCCCATTATCGACGTCGGAGTCAAGGAGTTTACGGCGACGGCAGAG
AATTGGTCGTCGAATCTGAAAGCCGAGGCGGCCATACACACGTACACGAACGTCTACAACTTTTCGAAATCCAGC
TGGGAGCCCCTGATCGAACCATGGCAAGTCGGCCTGGGCGTGGCCAGAGACTCGACTACGGGCGTGCTGTCGGTC
GACGTGGCCTCGGCAAAGACGCTCGATATCACAGTCACGACGGCGACCATCGCATTGGCTTCCAAGTCGCTCGCA
TTTCTCACGACGCAGGAAGATGTTTTGGATAAGCCGCGGTGGAGTGACGCGCCATATCGCATCAGAAACCACACG
GGCTTCGTCATCACGATGCACTCGCGCAGCCCAAGCAGCGAGGAGTTCATCGACCTGCGGCTCGAAGACGGAGAG
GAGGCACCGTGGACCTTTGAAGAATGGGAGAAGATGCGAGAGAACATCCTGACCGAAGCCGCCGCCCAGAACGAC
GTGGGCATAAAGTTGGAGGGCAGCGGCTTCGACACTGTCAAGAACGTGCGGGTGAACCGAGAGGGCGAGTTCCTC
TACAGCCTGCGGCCCAAGACGGACAATGTGACGCATCGGCTGTGCGTGGACGTACGTCTCGGGTCTGACAATGTC
AAGGACGTCACGCTACGGTCTCCGCTGCTTGTCGAGAACGCGACGGAGATCCCGGTCGAGCTCGGCATCTACGAC
GCTTCAGAGGGCCACCTTCTCAAGATCGAGAAGATCGCTCCCGGGGATTCGCGTCCAGCTCCGGTGGGTGCCGCG
TTCGAGAAGAGGGTCATTGTGCGTCCGGACAGCGGCTTCGGCTATCAGTGGAGCAGAGATCAGCTCTGGTGGAGG
GATCTGCTCAAGCGACCGACCAAGCAGCTCGTCTGCATTGGGGATACCGGCGACTCGTTCTACTTTCAGGTCCAC
GCGGACTTTGACAAGACCAACCCATTGACCAAGTGAGTATCATTGTTCTTTTGCCCGGTTCTGCGTTGACAAGGG
AATCCACAGGGCATACCCCTCGATGAAGATCAAGCTCTCGGCTCCGTTGACGCTGGAGAATCTGTTGCCGTACGA
CTTCAAGTACAGGATCTACGACAGGAACACTAAGAGGGACTGGTCCAACTTTTTGCGAAAGGGCGGCGTGAGCCC
CGTCCACATGGTGGAGCTCTCTCACCTCTTGCTCCTGAGTGTCGATATGCAGGACACCATCTTCAAGCCTAGCGA
CTTCTCCATCATCAACCCCGGGAGCAACGACGACTTCCGGAAGGAGAACCGGCTCGTGGTCAAGGACGAGCAAGG
CTTGACGCTGCATCTGAGCCTCCACTACTTCAAAGTGCCCAAGAGCGGGGGAGCGTTCAAGATCAGCGTATACAG
CCCCTACGTCGTGTTGAACAAGACGGGTCTCGACATGCGGATCCGCGCCAAGAGCTTCCTACAGCAGGCCAAGGC
GGCGGCCGGTCAATTCCCCGTGGTGCAGACGGGAAGCCAAGATAGACCGAAGGCGCTGCCGTTCATGTTCTCGTT
CGGAAACGACGAGCATCAGAACCGGGTGCTGCTCAAGGTGGACGAGTCGGAATGGAGCAAGCCGCAGAGCTTCGA
CGCGGTAGGGAGCACATCGGAAGTGATACTGAACTCGTCGACGTCCAAGCATAGGGAGATTCACCTGGGCATCAC
GGTCAAGTCGGGCGACGGCAAGTACAAGATGACGCGGGTCGTGACGCTGGCGCCGCGCTTCGTGCTGGTCAACAA
GCTGGGCGAGGAGATTCTGGTGCGCGAGTCGGGCTCGTCGAACCACATGACCATCAGATCAGGAGTCCTGCATCC
GCTACACTTTATGCAAAAGTCGGCGGTCAAGCAGCTGTGCCTGTGCTTCCCGGGCGTCGACAACCACTGGACGTC
GCCCTTTAACATCGCAGACCTCGGGACGACGCACGTCAAGATGACCAGGGCCGGACAGCGGCAGCGGCTGGTGCG
GCTTGAGATTCTTACAGAGGAGTCGACCATCTTCTTGCACATGAGCATCGAGGGCAAGCACTGGCCCTTTTCCAT
GCGTAACGAGAGCGACACCGAGTTCTCCTTTTACCAGGCCAACCCCAACGTCGACGAGGACGACGACGAGGACCG
AAGCGGATGGAAGCCGGTGCGGTACCGTCTGCCGCCTCGGAGCGTGATGCCGTACGCCTGGGACTTTCCGGCCGC
CAAGTTCCGCGAGGTGGTGATTTCTACCTGCGGCAAGGAGCGTCACGTCAAGCTGGCCGAGATGGGAAATCAGAT
CCCCATGAAGTTTACCGGCCCAGGCGGGCAGCAGAAGATCATCGACATCAACGTGGCTGCCGATGGGCCAATGCA
GACGCTCATCCTCAGCAACTTCCGGGCCAGCAGGAGCATGTTCAAGCCGGCGGCGGTGTCGAGAACCAACACGGG
GCCCGAGGCGTTCGAGGTCAAGGACCAGGGCACTGGGGCTACCATGTTGGCGCAGCTCAAGCTCTCGGGCATCGG
CATCTCGCTCATCAACGCGCACCTCAAGGAGCTGGCGTACGTGACGCTTCGCGAGGTGCAGCTACGGCTCAGCGA
CTCGCCGCTGATACAAACCATGTCGCTGGCGGTCAAGTGGATTCAGATCGACAACCAGCTGTACGGCGGCATATT
CCCCATAGTGCTGTACCCGAGCGTGGTGCCCAAGCGGGCCAACGAGGTCGAGGCGCACCCTTCGCTGCACGCCAT
GGTCAGCCGGGTCAAGGACGACTCGTACGGGGTGCTGTACATCAAGTACGCGACGGTGCTGCTGCAGCAGATGAC
GGTGGACCTGGACGAGGACTTTGTCTTTGCTCTTCTCGACTTCTCCAACGTTCCGGGCGCCAGCTGGACGGCGGT
CGAAGGATCCGGATCGGGCCGGCTGTGCGACGAAGACCTCGACATCCCCGAGCCGTCGCAGCAGCAGTCCGGGCA
GGACATGTACTTTGAGGTGCTCAATATTCAGCCGATGCAGATCGACCTCAGCTTCGTGCGGACGGAGCGAGTCAA
TGCCGAGGATAAGACGTCGACGCGGAACCCCATCATGTTCTTCCTCAACGTCATGACCATGGCCATTGGCAACGT
CAACGACGCACCTGTTCGCTTCAACGCGCTGATGCTGGACAATGTGAGGGTGTCGCAGGCGGTGCTGGTGCAGAA
CGTGTCGAGCCACTACAGCCAAGAGGTCATGTATCAGATCCACAAGATCCTGGGCTCGGCCGACTTTCTGGGCAA
CCCGGTCGGCCTGTTCAACAACATCTCGTCGGGCGTGACGGACATCTTTTACGAGCCGTACCAGGGGCTCATCCT
CTCGGACCGACCCGAGGAGTTTGGCATCGGTATCGCGCGCGGAGCCGTTTCGTTTGCCAAGAAGACGGTCTACGG
CTTCAGCGACAGCTTCTCCAAGTTTACGGGCAGCCTGGGCAAGGGCCTGGCGGCGGCATCGCTGGACAAGCAGTT
CCAGGACCGGCGGCGAATTACGAGGGCTCGCAACCGGCCCAAACACGCGCTGTACGGGGTGGCGGCGGGTGCCAA
CTCGCTGCTGACGAGCGTGGCTTCGGGAGTCGGGGGCCTGGCGCGCAAGCCGCTCGAGGGGGCGGAGCAGGAGGG
CGCCCTGGGCTTCTTCAAGGGCGTGGGCAAGGGCGTGCTCGGGCTGGCGACGAAGCCGGCGGTCGGGGTGCTGGA
CATGGCGAGCAACGTCAGCGAGGGCATCCGCAACACGACGACGGTCTTTGACGGATCGGAGCTGGAGCGGACGCG
GCTGCCGCGGTTCATGGCCAACGACGGCATCGTGAGGCCGTACGGGGCGCGAGAGGCTCTGGGCCAGTTCTGGCT
GAAGCAGGTCGACAACGGCAAGTACTTTGACGAGCAGTACGTCGGCCACCTGGAGCTGCCTCGCGAGGACATGGT
GGTCATGGTGACGTTCGCGCGCATCCTGCTGATTCGGTCTCGGCGCCTGACGAGCGAGTGGGACGTCAAGCTCAA
GGACGTGCAGACGGTGGCCAAGGAGAGGACGGGCGTGAGCCTGACGCTGCGGGGGGGCACCAACGGGCCGTTCAT
CCCGGTGGGCGGCGGCAGCGAGCGGGGATACCTGTACCGGATGATTGGGGTGGCGGCCGAGGAATTCAATCGGCG
TTTCCGGGGCGCCGAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail