Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2026
Gene name
LocationContig_194:7975..9490
Strand-
Gene length (bp)1515
Transcript length (bp)1401
Coding sequence length (bp)1401
Protein length (aa) 467

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11911 DUF3429 Protein of unknown function (DUF3429) 4.0E-45 97 261

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P0C6U3|R1A_CVHN1 Replicase polyprotein 1a OS=Human coronavirus HKU1 (isolate N1) GN=1a PE=1 SV=1 319 460 3.0E-06
sp|P0C6X2|R1AB_CVHN1 Replicase polyprotein 1ab OS=Human coronavirus HKU1 (isolate N1) GN=rep PE=3 SV=1 319 460 3.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 25 0.45

Transmembrane Domains

Domain # Start End Length
1 102 124 22
2 157 179 22
3 192 214 22
4 243 262 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2026
MRAPFQSQLVVSSRARSQLRFASSDSKTPPPRNSGEQLQKPVAEKLEVRPDKVSDRSSVRTIFEKSPPSAPKKDA
DLGRELKHDIAVFRDTFRLSDVPQESRILGLAGTLPYVATSLSTLFLAWDLNRDIPTGNSIFDPIFIDHETAQYL
LNLIEPLQLGYGAVIISFLGAIHWGLEYAEKQPSRSRTRFRYGIGVAASVVAWPTVLMPIEHALTAQFFAFVALY
FADSRASSRGWAPYWYNTYRFLLTAIVGLAILVSLVGRANIGVQGRLSSSGLTSSMTTPGIADRETDWVKLEEEE
KARIKKEEEEKAKKRKQKEAAERKKGGKKGGKKKDDQDKAKGNAAGTKDEEEADNDGEEEEDSEDGEKGEEGEDG
EDGENDDDGEKEDDNNEEEDGEDDKGDEDDEKKAEGTNSKDNNGKDDEAKKDSKKKDSKAKDAKKQNNSQDDADK
DDEADADSKTKAKKKR*
Coding >Ophun1|2026
ATGCGTGCTCCTTTCCAATCACAGCTCGTCGTGTCTTCGCGAGCACGTTCCCAGCTCCGTTTCGCCAGCAGCGAC
TCCAAGACGCCTCCTCCGCGGAACAGCGGCGAGCAGCTGCAGAAACCGGTGGCCGAGAAGCTCGAAGTACGACCC
GACAAGGTCTCGGATCGGAGCTCCGTACGGACCATCTTTGAAAAGTCTCCGCCGTCTGCCCCCAAGAAGGACGCA
GATCTGGGCCGCGAACTGAAGCATGACATCGCAGTCTTTCGCGACACCTTTCGCCTCTCTGACGTGCCGCAAGAG
TCGCGCATCCTCGGTCTCGCCGGCACGCTTCCTTATGTCGCGACCTCGCTCTCGACTCTCTTCTTGGCCTGGGAT
CTGAACAGGGATATACCGACGGGCAACTCGATCTTTGACCCCATCTTTATCGACCACGAGACGGCCCAGTATCTC
CTCAATCTCATTGAGCCGCTACAGCTTGGATACGGAGCCGTCATCATCTCCTTTCTCGGTGCAATCCACTGGGGA
CTCGAGTATGCTGAGAAGCAGCCTTCGCGCTCGCGGACGCGATTCCGCTACGGCATCGGCGTCGCCGCCTCCGTC
GTAGCCTGGCCAACCGTCCTCATGCCCATCGAGCACGCTCTGACGGCCCAATTCTTTGCTTTCGTCGCCCTTTAC
TTTGCCGACTCGAGGGCGTCGTCGCGAGGATGGGCTCCCTATTGGTACAACACGTACCGCTTCCTCCTCACGGCC
ATCGTCGGTCTCGCCATCCTCGTGTCTCTGGTGGGCAGGGCCAATATCGGCGTCCAGGGAAGGCTCAGCTCTTCG
GGCCTTACCTCGAGCATGACCACCCCGGGCATCGCCGACCGCGAGACTGACTGGGTTAAGCTGGAGGAAGAGGAG
AAAGCCAGGATCAAGAAAGAGGAGGAGGAGAAGGCCAAGAAGAGGAAGCAGAAGGAAGCGGCCGAGCGCAAGAAG
GGCGGCAAGAAGGGCGGCAAGAAGAAGGACGACCAGGACAAGGCCAAGGGAAATGCCGCGGGAACAAAAGACGAG
GAAGAGGCTGACAATGACGGCGAAGAGGAAGAGGATAGTGAAGATGGAGAGAAAGGGGAGGAAGGGGAAGATGGC
GAGGACGGCGAGAATGATGACGATGGCGAGAAGGAGGACGACAATAATGAGGAGGAAGATGGCGAGGACGACAAG
GGTGACGAGGATGACGAGAAGAAGGCCGAGGGCACCAACAGCAAAGACAACAACGGCAAGGACGACGAGGCCAAG
AAGGATAGCAAGAAGAAAGACTCCAAGGCCAAGGACGCCAAGAAGCAAAACAACAGCCAAGACGACGCAGACAAA
GACGACGAAGCCGACGCCGACTCCAAGACCAAGGCTAAGAAGAAACGGTAG
Transcript >Ophun1|2026
ATGCGTGCTCCTTTCCAATCACAGCTCGTCGTGTCTTCGCGAGCACGTTCCCAGCTCCGTTTCGCCAGCAGCGAC
TCCAAGACGCCTCCTCCGCGGAACAGCGGCGAGCAGCTGCAGAAACCGGTGGCCGAGAAGCTCGAAGTACGACCC
GACAAGGTCTCGGATCGGAGCTCCGTACGGACCATCTTTGAAAAGTCTCCGCCGTCTGCCCCCAAGAAGGACGCA
GATCTGGGCCGCGAACTGAAGCATGACATCGCAGTCTTTCGCGACACCTTTCGCCTCTCTGACGTGCCGCAAGAG
TCGCGCATCCTCGGTCTCGCCGGCACGCTTCCTTATGTCGCGACCTCGCTCTCGACTCTCTTCTTGGCCTGGGAT
CTGAACAGGGATATACCGACGGGCAACTCGATCTTTGACCCCATCTTTATCGACCACGAGACGGCCCAGTATCTC
CTCAATCTCATTGAGCCGCTACAGCTTGGATACGGAGCCGTCATCATCTCCTTTCTCGGTGCAATCCACTGGGGA
CTCGAGTATGCTGAGAAGCAGCCTTCGCGCTCGCGGACGCGATTCCGCTACGGCATCGGCGTCGCCGCCTCCGTC
GTAGCCTGGCCAACCGTCCTCATGCCCATCGAGCACGCTCTGACGGCCCAATTCTTTGCTTTCGTCGCCCTTTAC
TTTGCCGACTCGAGGGCGTCGTCGCGAGGATGGGCTCCCTATTGGTACAACACGTACCGCTTCCTCCTCACGGCC
ATCGTCGGTCTCGCCATCCTCGTGTCTCTGGTGGGCAGGGCCAATATCGGCGTCCAGGGAAGGCTCAGCTCTTCG
GGCCTTACCTCGAGCATGACCACCCCGGGCATCGCCGACCGCGAGACTGACTGGGTTAAGCTGGAGGAAGAGGAG
AAAGCCAGGATCAAGAAAGAGGAGGAGGAGAAGGCCAAGAAGAGGAAGCAGAAGGAAGCGGCCGAGCGCAAGAAG
GGCGGCAAGAAGGGCGGCAAGAAGAAGGACGACCAGGACAAGGCCAAGGGAAATGCCGCGGGAACAAAAGACGAG
GAAGAGGCTGACAATGACGGCGAAGAGGAAGAGGATAGTGAAGATGGAGAGAAAGGGGAGGAAGGGGAAGATGGC
GAGGACGGCGAGAATGATGACGATGGCGAGAAGGAGGACGACAATAATGAGGAGGAAGATGGCGAGGACGACAAG
GGTGACGAGGATGACGAGAAGAAGGCCGAGGGCACCAACAGCAAAGACAACAACGGCAAGGACGACGAGGCCAAG
AAGGATAGCAAGAAGAAAGACTCCAAGGCCAAGGACGCCAAGAAGCAAAACAACAGCCAAGACGACGCAGACAAA
GACGACGAAGCCGACGCCGACTCCAAGACCAAGGCTAAGAAGAAACGGTAG
Gene >Ophun1|2026
ATGCGTGCTCCTTTCCAATCACAGCTCGTCGTGTCTTCGCGAGCACGTTCCCAGCTCCGTTTCGCCAGCAGCGAC
TCCAAGACGCCTCCTCCGCGGAACAGCGGCGAGCAGCTGCAGAAACCGGTGGCCGAGAAGCTCGAAGTACGACCC
GACAAGGTCTCGGATCGGAGCTCCGTACGGACCATCTTTGAAAAGTCTCCGCCGTCTGCCCCCAAGAAGGACGCA
GATCTGGGCCGCGAACTGAAGCATGACATCGTGAGAGCGAGCAATAGCTAGTCGTCAGCCTGGACAACTGACCAA
CCGGTGGGCAGGCAGTCTTTCGCGACACCTTTCGCCTCTCTGACGTGCCGCAAGAGTCGCGCATCCTCGGTCTCG
CCGGCACGCTTCCTTATGTCGCGACCTCGCTCTCGACTCTCTTCTTGGCCTGGGATCTGAACAGGGATATACCGA
CGGGCAACTCGATCTTTGACCCCATCTTTATCGACCACGAGACGGCCCAGTATCTCCTCAATCTCATTGAGCCGC
TACAGCTTGGATACGGAGCCGTCATCATCTCCTTTCTCGGTGCAATCCACTGGGTAAGTGCCCCGTCCGGGAGAT
GTAATAGAAGCACGTGCTGACGCTGGACGTCTCTAGGGACTCGAGTATGCTGAGAAGCAGCCTTCGCGCTCGCGG
ACGCGATTCCGCTACGGCATCGGCGTCGCCGCCTCCGTCGTAGCCTGGCCAACCGTCCTCATGCCCATCGAGCAC
GCTCTGACGGCCCAATTCTTTGCTTTCGTCGCCCTTTACTTTGCCGACTCGAGGGCGTCGTCGCGAGGATGGGCT
CCCTATTGGTACAACACGTACCGCTTCCTCCTCACGGCCATCGTCGGTCTCGCCATCCTCGTGTCTCTGGTGGGC
AGGGCCAATATCGGCGTCCAGGGAAGGCTCAGCTCTTCGGGCCTTACCTCGAGCATGACCACCCCGGGCATCGCC
GACCGCGAGACTGACTGGGTTAAGCTGGAGGAAGAGGAGAAAGCCAGGATCAAGAAAGAGGAGGAGGAGAAGGCC
AAGAAGAGGAAGCAGAAGGAAGCGGCCGAGCGCAAGAAGGGCGGCAAGAAGGGCGGCAAGAAGAAGGACGACCAG
GACAAGGCCAAGGGAAATGCCGCGGGAACAAAAGACGAGGAAGAGGCTGACAATGACGGCGAAGAGGAAGAGGAT
AGTGAAGATGGAGAGAAAGGGGAGGAAGGGGAAGATGGCGAGGACGGCGAGAATGATGACGATGGCGAGAAGGAG
GACGACAATAATGAGGAGGAAGATGGCGAGGACGACAAGGGTGACGAGGATGACGAGAAGAAGGCCGAGGGCACC
AACAGCAAAGACAACAACGGCAAGGACGACGAGGCCAAGAAGGATAGCAAGAAGAAAGACTCCAAGGCCAAGGAC
GCCAAGAAGCAAAACAACAGCCAAGACGACGCAGACAAAGACGACGAAGCCGACGCCGACTCCAAGACCAAGGCT
AAGAAGAAACGGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail