Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|202
Gene name
LocationContig_104:1740..3755
Strand+
Gene length (bp)2015
Transcript length (bp)1749
Coding sequence length (bp)1749
Protein length (aa) 583

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 1.8E-32 57 465
PF06609 TRI12 Fungal trichothecene efflux pump (TRI12) 1.6E-12 97 488

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P96712|BMR3_BACSU Multidrug resistance protein 3 OS=Bacillus subtilis (strain 168) GN=bmr3 PE=1 SV=1 64 479 5.0E-40
sp|O42922|YBIH_SCHPO Uncharacterized MFS-type transporter C16A3.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC16A3.17c PE=3 SV=1 14 568 2.0E-39
sp|Q10072|YAN6_SCHPO Uncharacterized transporter C3H1.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3H1.06c PE=3 SV=1 49 491 2.0E-36
sp|P9WG85|Y1877_MYCTU Uncharacterized MFS-type transporter Rv1877 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1877 PE=3 SV=1 39 541 3.0E-35
sp|P9WG84|Y1877_MYCTO Uncharacterized MFS-type transporter MT1926 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1926 PE=3 SV=1 39 541 3.0E-35
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P96712|BMR3_BACSU Multidrug resistance protein 3 OS=Bacillus subtilis (strain 168) GN=bmr3 PE=1 SV=1 64 479 5.0E-40
sp|O42922|YBIH_SCHPO Uncharacterized MFS-type transporter C16A3.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC16A3.17c PE=3 SV=1 14 568 2.0E-39
sp|Q10072|YAN6_SCHPO Uncharacterized transporter C3H1.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3H1.06c PE=3 SV=1 49 491 2.0E-36
sp|P9WG85|Y1877_MYCTU Uncharacterized MFS-type transporter Rv1877 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1877 PE=3 SV=1 39 541 3.0E-35
sp|P9WG84|Y1877_MYCTO Uncharacterized MFS-type transporter MT1926 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1926 PE=3 SV=1 39 541 3.0E-35
sp|Q9HE13|YI32_SCHPO Uncharacterized MFS-type transporter C1399.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1399.02 PE=3 SV=1 33 484 6.0E-34
sp|O32182|YUSP_BACSU Uncharacterized MFS-type transporter YusP OS=Bacillus subtilis (strain 168) GN=yusP PE=3 SV=1 49 474 2.0E-28
sp|P36172|VBA5_YEAST Vacuolar basic amino acid transporter 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VBA5 PE=3 SV=1 23 479 9.0E-27
sp|Q00357|TOXA_COCCA Putative HC-toxin efflux carrier TOXA OS=Cochliobolus carbonum GN=TOXA PE=3 SV=1 65 478 9.0E-25
sp|P0AEJ0|EMRB_ECOLI Multidrug export protein EmrB OS=Escherichia coli (strain K12) GN=emrB PE=1 SV=1 43 490 1.0E-24
sp|P0AEJ1|EMRB_ECO57 Multidrug export protein EmrB OS=Escherichia coli O157:H7 GN=emrB PE=3 SV=1 43 490 1.0E-24
sp|Q00538|MMR_BACSU Methylenomycin A resistance protein OS=Bacillus subtilis (strain 168) GN=mmr PE=3 SV=1 53 380 2.0E-23
sp|P38358|VBA2_YEAST Vacuolar basic amino acid transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VBA2 PE=1 SV=1 90 524 1.0E-21
sp|P31474|HSRA_ECOLI Probable transport protein HsrA OS=Escherichia coli (strain K12) GN=hsrA PE=1 SV=1 59 491 9.0E-21
sp|O59726|FNX2_SCHPO Vacuolar membrane amino acid uptake transporter fnx2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fnx2 PE=3 SV=1 67 543 3.0E-20
sp|P9WG87|Y1250_MYCTU Uncharacterized MFS-type transporter Rv1250 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1250 PE=3 SV=1 56 365 2.0E-19
sp|P9WG86|Y1250_MYCTO Uncharacterized MFS-type transporter MT1289 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1289 PE=3 SV=1 56 365 2.0E-19
sp|P39886|TCMA_STRGA Tetracenomycin C resistance and export protein OS=Streptomyces glaucescens GN=tcmA PE=3 SV=1 32 472 1.0E-18
sp|B5BP47|YP53_SCHPO Uncharacterized transporter C460.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC460.03 PE=3 SV=1 55 532 1.0E-18
sp|P9WG90|STP_MYCTO Multidrug resistance protein Stp OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=stp PE=3 SV=1 50 498 2.0E-18
sp|P44927|EMRB_HAEIN Multidrug export protein EmrB OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=emrB PE=3 SV=1 66 480 6.0E-18
sp|B5XPB7|MDTD_KLEP3 Putative multidrug resistance protein MdtD OS=Klebsiella pneumoniae (strain 342) GN=mdtD PE=3 SV=1 60 364 7.0E-18
sp|P33335|SGE1_YEAST Protein SGE1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SGE1 PE=1 SV=1 67 432 2.0E-17
sp|P76269|YEBQ_ECOLI Uncharacterized transporter YebQ OS=Escherichia coli (strain K12) GN=yebQ PE=3 SV=2 36 474 2.0E-17
sp|P50080|AZR1_YEAST Azole resistance protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AZR1 PE=1 SV=1 67 401 2.0E-17
sp|P25594|VBA3_YEAST Vacuolar basic amino acid transporter 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VBA3 PE=1 SV=1 139 479 3.0E-17
sp|P9WG91|STP_MYCTU Multidrug resistance protein Stp OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=stp PE=1 SV=1 50 498 4.0E-17
sp|O31563|YFIU_BACSU Uncharacterized MFS-type transporter YfiU OS=Bacillus subtilis (strain 168) GN=yfiU PE=3 SV=1 59 381 4.0E-17
sp|A6TBH6|MDTD_KLEP7 Putative multidrug resistance protein MdtD OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=mdtD PE=3 SV=1 60 364 5.0E-17
sp|P52600|EMRY_ECOLI Probable multidrug resistance protein EmrY OS=Escherichia coli (strain K12) GN=emrY PE=2 SV=1 42 487 6.0E-17
sp|P9WG88|EMRB_MYCTO Multidrug resistance protein B homolog OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=emrB PE=3 SV=1 55 479 2.0E-16
sp|P9WG89|EMRB_MYCTU Multidrug resistance protein B homolog OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=emrB PE=3 SV=1 55 479 2.0E-16
sp|P0A0J9|QACA_STAAU Antiseptic resistance protein OS=Staphylococcus aureus GN=qacA PE=1 SV=1 49 363 4.0E-16
sp|P0A0J8|QACA_STAAM Antiseptic resistance protein OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=qacA PE=3 SV=1 49 363 4.0E-16
sp|A4WCC3|MDTD_ENT38 Putative multidrug resistance protein MdtD OS=Enterobacter sp. (strain 638) GN=mdtD PE=3 SV=1 60 364 2.0E-15
sp|A8GHR1|MDTD_SERP5 Putative multidrug resistance protein MdtD OS=Serratia proteamaculans (strain 568) GN=mdtD PE=3 SV=1 60 364 3.0E-15
sp|Q9CCP7|MFS55_MYCLE MFS-type drug efflux transporter P55 OS=Mycobacterium leprae (strain TN) GN=ML0556 PE=3 SV=1 59 390 4.0E-15
sp|Q6D2A9|MDTD_PECAS Putative multidrug resistance protein MdtD OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=mdtD PE=3 SV=1 60 364 4.0E-15
sp|Q04301|VBA1_YEAST Vacuolar basic amino acid transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VBA1 PE=1 SV=1 53 375 5.0E-15
sp|B4T9U3|MDTD_SALHS Putative multidrug resistance protein MdtD OS=Salmonella heidelberg (strain SL476) GN=mdtD PE=3 SV=1 46 272 6.0E-15
sp|A9N7L0|MDTD_SALPB Putative multidrug resistance protein MdtD OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=mdtD PE=3 SV=1 46 272 6.0E-15
sp|C6DBD0|MDTD_PECCP Putative multidrug resistance protein MdtD OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=mdtD PE=3 SV=1 60 364 1.0E-14
sp|B4SXW2|MDTD_SALNS Putative multidrug resistance protein MdtD OS=Salmonella newport (strain SL254) GN=mdtD PE=3 SV=1 46 272 1.0E-14
sp|B5R0C2|MDTD_SALEP Putative multidrug resistance protein MdtD OS=Salmonella enteritidis PT4 (strain P125109) GN=mdtD PE=3 SV=1 46 272 1.0E-14
sp|B5EXV9|MDTD_SALA4 Putative multidrug resistance protein MdtD OS=Salmonella agona (strain SL483) GN=mdtD PE=3 SV=1 46 272 1.0E-14
sp|B5FMU8|MDTD_SALDC Putative multidrug resistance protein MdtD OS=Salmonella dublin (strain CT_02021853) GN=mdtD PE=3 SV=1 46 272 2.0E-14
sp|B5BF67|MDTD_SALPK Putative multidrug resistance protein MdtD OS=Salmonella paratyphi A (strain AKU_12601) GN=mdtD PE=3 SV=1 46 272 2.0E-14
sp|Q5PDW9|MDTD_SALPA Putative multidrug resistance protein MdtD OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=mdtD PE=3 SV=1 46 272 2.0E-14
sp|A8AEE4|MDTD_CITK8 Putative multidrug resistance protein MdtD OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=mdtD PE=3 SV=1 46 364 2.0E-14
sp|Q8ZNQ0|MDTD_SALTY Putative multidrug resistance protein MdtD OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=mdtD PE=3 SV=1 46 272 3.0E-14
sp|B4TNI8|MDTD_SALSV Putative multidrug resistance protein MdtD OS=Salmonella schwarzengrund (strain CVM19633) GN=mdtD PE=3 SV=1 46 225 3.0E-14
sp|O34502|YVKA_BACSU Uncharacterized MFS-type transporter YvkA OS=Bacillus subtilis (strain 168) GN=yvkA PE=3 SV=1 49 254 3.0E-14
sp|B1JSD2|MDTD_YERPY Putative multidrug resistance protein MdtD OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=mdtD PE=3 SV=1 60 364 4.0E-14
sp|A4TMR4|MDTD_YERPP Putative multidrug resistance protein MdtD OS=Yersinia pestis (strain Pestoides F) GN=mdtD PE=3 SV=1 60 364 4.0E-14
sp|Q1CK62|MDTD_YERPN Putative multidrug resistance protein MdtD OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=mdtD PE=3 SV=1 60 364 4.0E-14
sp|A9QZU7|MDTD_YERPG Putative multidrug resistance protein MdtD OS=Yersinia pestis bv. Antiqua (strain Angola) GN=mdtD PE=3 SV=1 60 364 4.0E-14
sp|Q7CJL1|MDTD_YERPE Putative multidrug resistance protein MdtD OS=Yersinia pestis GN=mdtD PE=3 SV=1 60 364 4.0E-14
sp|B2K9M2|MDTD_YERPB Putative multidrug resistance protein MdtD OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=mdtD PE=3 SV=1 60 364 4.0E-14
sp|Q1C5L8|MDTD_YERPA Putative multidrug resistance protein MdtD OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=mdtD PE=3 SV=1 60 364 4.0E-14
sp|A7FG15|MDTD_YERP3 Putative multidrug resistance protein MdtD OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=mdtD PE=3 SV=1 60 364 4.0E-14
sp|P9WJY5|EFPA_MYCTU Uncharacterized MFS-type transporter EfpA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=efpA PE=1 SV=1 31 394 6.0E-14
sp|P9WJY4|EFPA_MYCTO Uncharacterized MFS-type transporter EfpA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=efpA PE=3 SV=1 31 394 6.0E-14
sp|Q668C4|MDTD_YERPS Putative multidrug resistance protein MdtD OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=mdtD PE=3 SV=1 60 364 6.0E-14
sp|Q8Z5F5|MDTD_SALTI Putative multidrug resistance protein MdtD OS=Salmonella typhi GN=mdtD PE=3 SV=1 46 272 7.0E-14
sp|A1JKW8|MDTD_YERE8 Putative multidrug resistance protein MdtD OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=mdtD PE=3 SV=2 45 364 2.0E-13
sp|P9WJW9|Y2459_MYCTU Uncharacterized MFS-type transporter Rv2459 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv2459 PE=3 SV=1 49 496 2.0E-13
sp|P9WJW8|Y2459_MYCTO Uncharacterized MFS-type transporter MT2534 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT2534 PE=3 SV=1 49 496 2.0E-13
sp|Q09752|FNX1_SCHPO Multidrug resistance protein fnx1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fnx1 PE=2 SV=2 48 529 4.0E-13
sp|Q8Y9K8|LMRB_LISMO Lincomycin resistance protein LmrB OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=lmrB PE=3 SV=1 86 362 3.0E-12
sp|P46105|ACT22_STRCO Probable actinorhodin transporter OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=actII-2 PE=3 SV=1 41 473 3.0E-12
sp|Q92EE1|LMRB_LISIN Lincomycin resistance protein LmrB OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=lmrB PE=3 SV=1 86 362 6.0E-12
sp|P46104|LMRA_STRLN Lincomycin resistance protein OS=Streptomyces lincolnensis GN=lmrA PE=3 SV=1 52 363 1.0E-11
sp|B7LV41|MDTD_ESCF3 Putative multidrug resistance protein MdtD OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=mdtD PE=3 SV=1 46 364 1.0E-11
sp|P9WJY3|MFS55_MYCTU MFS-type drug efflux transporter P55 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1410c PE=1 SV=1 59 301 2.0E-11
sp|P9WJY2|MFS55_MYCTO MFS-type drug efflux transporter P55 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1454 PE=3 SV=1 59 301 2.0E-11
sp|C6DTH3|MFS55_MYCTK MFS-type drug efflux transporter P55 OS=Mycobacterium tuberculosis (strain KZN 1435 / MDR) GN=TBMG_02570 PE=3 SV=1 59 301 2.0E-11
sp|A5WM93|MFS55_MYCTF MFS-type drug efflux transporter P55 OS=Mycobacterium tuberculosis (strain F11) GN=TBFG_11439 PE=3 SV=1 59 301 2.0E-11
sp|A5U2B2|MFS55_MYCTA MFS-type drug efflux transporter P55 OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=MRA_1419 PE=3 SV=1 59 301 2.0E-11
sp|C1AN55|MFS55_MYCBT MFS-type drug efflux transporter P55 OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=JTY_1446 PE=3 SV=1 59 301 2.0E-11
sp|A1KIJ9|MFS55_MYCBP MFS-type drug efflux transporter P55 OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=BCG_1471c PE=1 SV=1 59 301 2.0E-11
sp|Q7U042|MFS55_MYCBO MFS-type drug efflux transporter P55 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb1445c PE=3 SV=1 59 301 2.0E-11
sp|P54585|YHCA_BACSU Uncharacterized MFS-type transporter YhcA OS=Bacillus subtilis (strain 168) GN=yhcA PE=3 SV=2 53 494 3.0E-11
sp|Q9P6J7|YHD3_SCHPO Uncharacterized MFS-type transporter C1683.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1683.03c PE=3 SV=1 26 319 5.0E-11
sp|P37594|SMVA_SALTY Methyl viologen resistance protein SmvA OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=smvA PE=3 SV=2 49 434 8.0E-11
sp|D0ZXQ3|SMVA_SALT1 Methyl viologen resistance protein SmvA OS=Salmonella typhimurium (strain 14028s / SGSC 2262) GN=smvA PE=1 SV=1 49 434 8.0E-11
sp|A7MHI9|MDTD_CROS8 Putative multidrug resistance protein MdtD OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=mdtD PE=3 SV=1 60 364 2.0E-10
sp|P42670|PUR8_STRAD Puromycin resistance protein pur8 OS=Streptomyces alboniger GN=pur8 PE=3 SV=1 41 373 2.0E-10
sp|P94422|YCNB_BACSU Uncharacterized MFS-type transporter YcnB OS=Bacillus subtilis (strain 168) GN=ycnB PE=3 SV=1 36 370 1.0E-09
sp|P34698|Y5813_SACEN Uncharacterized MFS-type transporter SACE_5813 OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=SACE_5813 PE=3 SV=2 32 434 1.0E-09
sp|P44903|HSRA_HAEIN Probable transport protein HsrA OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=hsrA PE=3 SV=1 59 363 3.0E-09
sp|O35018|LMRB_BACSU Lincomycin resistance protein LmrB OS=Bacillus subtilis (strain 168) GN=lmrB PE=3 SV=1 53 362 3.0E-09
sp|P11545|MMR_STRCO Methylenomycin A resistance protein OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=mmr PE=3 SV=1 44 383 4.0E-09
sp|Q0TG13|MDTD_ECOL5 Putative multidrug resistance protein MdtD OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=mdtD PE=3 SV=1 46 228 4.0E-09
sp|B7NQA9|MDTD_ECO7I Putative multidrug resistance protein MdtD OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=mdtD PE=3 SV=1 46 228 4.0E-09
sp|B7NCB3|MDTD_ECOLU Putative multidrug resistance protein MdtD OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=mdtD PE=3 SV=1 46 228 4.0E-09
sp|B5YUD5|MDTD_ECO5E Putative multidrug resistance protein MdtD OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=mdtD PE=3 SV=1 46 228 4.0E-09
sp|Q8X7I3|MDTD_ECO57 Putative multidrug resistance protein MdtD OS=Escherichia coli O157:H7 GN=mdtD PE=3 SV=1 46 228 4.0E-09
sp|Q1R9Z4|MDTD_ECOUT Putative multidrug resistance protein MdtD OS=Escherichia coli (strain UTI89 / UPEC) GN=mdtD PE=3 SV=1 46 228 4.0E-09
sp|B7ME89|MDTD_ECO45 Putative multidrug resistance protein MdtD OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=mdtD PE=3 SV=1 46 228 4.0E-09
sp|A7ZNQ0|MDTD_ECO24 Putative multidrug resistance protein MdtD OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=mdtD PE=3 SV=1 46 228 4.0E-09
sp|B7UTB5|MDTD_ECO27 Putative multidrug resistance protein MdtD OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=mdtD PE=3 SV=1 46 364 4.0E-09
sp|A1ACT2|MDTD_ECOK1 Putative multidrug resistance protein MdtD OS=Escherichia coli O1:K1 / APEC GN=mdtD PE=3 SV=1 46 228 4.0E-09
sp|B7L9V0|MDTD_ECO55 Putative multidrug resistance protein MdtD OS=Escherichia coli (strain 55989 / EAEC) GN=mdtD PE=3 SV=1 46 228 5.0E-09
sp|B6HYS2|MDTD_ECOSE Putative multidrug resistance protein MdtD OS=Escherichia coli (strain SE11) GN=mdtD PE=3 SV=1 46 228 5.0E-09
sp|B7M460|MDTD_ECO8A Putative multidrug resistance protein MdtD OS=Escherichia coli O8 (strain IAI1) GN=mdtD PE=3 SV=1 46 228 5.0E-09
sp|B1LNW4|MDTD_ECOSM Putative multidrug resistance protein MdtD OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=mdtD PE=3 SV=1 46 228 5.0E-09
sp|Q83QZ0|MDTD_SHIFL Putative multidrug resistance protein MdtD OS=Shigella flexneri GN=mdtD PE=3 SV=1 46 228 5.0E-09
sp|Q3Z0C7|MDTD_SHISS Putative multidrug resistance protein MdtD OS=Shigella sonnei (strain Ss046) GN=mdtD PE=3 SV=1 46 217 5.0E-09
sp|B2TYA6|MDTD_SHIB3 Putative multidrug resistance protein MdtD OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=mdtD PE=3 SV=1 46 217 5.0E-09
sp|P36554|MDTD_ECOLI Putative multidrug resistance protein MdtD OS=Escherichia coli (strain K12) GN=mdtD PE=1 SV=2 46 217 5.0E-09
sp|B1IYZ7|MDTD_ECOLC Putative multidrug resistance protein MdtD OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=mdtD PE=3 SV=1 46 217 5.0E-09
sp|A8A1U9|MDTD_ECOHS Putative multidrug resistance protein MdtD OS=Escherichia coli O9:H4 (strain HS) GN=mdtD PE=3 SV=1 46 217 5.0E-09
sp|B1X7H3|MDTD_ECODH Putative multidrug resistance protein MdtD OS=Escherichia coli (strain K12 / DH10B) GN=mdtD PE=3 SV=1 46 217 5.0E-09
sp|C4ZSG5|MDTD_ECOBW Putative multidrug resistance protein MdtD OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=mdtD PE=3 SV=1 46 217 5.0E-09
sp|Q323D8|MDTD_SHIBS Putative multidrug resistance protein MdtD OS=Shigella boydii serotype 4 (strain Sb227) GN=mdtD PE=3 SV=1 46 217 6.0E-09
sp|Q8FG02|MDTD_ECOL6 Putative multidrug resistance protein MdtD OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=mdtD PE=3 SV=1 46 217 8.0E-09
sp|B7MWZ0|MDTD_ECO81 Putative multidrug resistance protein MdtD OS=Escherichia coli O81 (strain ED1a) GN=mdtD PE=3 SV=1 46 228 8.0E-09
sp|Q0T353|MDTD_SHIF8 Putative multidrug resistance protein MdtD OS=Shigella flexneri serotype 5b (strain 8401) GN=mdtD PE=3 SV=2 46 228 9.0E-09
sp|P94574|YWOD_BACSU Uncharacterized MFS-type transporter YwoD OS=Bacillus subtilis (strain 168) GN=ywoD PE=3 SV=1 60 493 1.0E-08
sp|Q08902|YO378_YEAST Drug resistance protein YOR378W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOR378W PE=1 SV=1 23 436 2.0E-08
sp|P23054|TCRB_BACSU Tetracycline resistance protein OS=Bacillus subtilis (strain 168) GN=tetB PE=3 SV=1 49 210 3.0E-08
sp|Q99S97|SDRM_STAAN Multidrug efflux pump SdrM OS=Staphylococcus aureus (strain N315) GN=sdrM PE=1 SV=1 48 209 5.0E-08
sp|Q04733|CMCT_AMYLA Cephamycin export protein CmcT OS=Amycolatopsis lactamdurans GN=cmcT PE=3 SV=1 66 362 1.0E-07
sp|P38124|FLR1_YEAST Fluconazole resistance protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FLR1 PE=1 SV=1 95 241 1.0E-07
sp|Q59XM0|QDR3_CANAL MFS antiporter QDR3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR3 PE=2 SV=1 46 249 2.0E-07
sp|O74395|STR1_SCHPO Siderophore iron transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=str1 PE=1 SV=1 106 419 3.0E-07
sp|P32369|BAIG_CLOSV Bile acid transporter OS=Clostridium scindens (strain JCM 10418 / VPI 12708) GN=baiG PE=3 SV=2 84 330 3.0E-07
sp|P13090|ATR1_YEAST Aminotriazole resistance protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ATR1 PE=1 SV=2 90 357 7.0E-06
sp|P53943|AQR1_YEAST Probable transporter AQR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AQR1 PE=1 SV=1 62 215 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0051179 localization No
GO:0005215 transporter activity No
GO:0051234 establishment of localization No
GO:0003674 molecular_function No
GO:0009987 cellular process No
GO:0006810 transport No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 40 0.5

Transmembrane Domains

Domain # Start End Length
1 48 70 22
2 85 107 22
3 119 141 22
4 175 197 22
5 204 226 22
6 276 298 22
7 319 341 22
8 356 378 22
9 385 405 20
10 420 442 22
11 455 477 22
12 519 541 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|202
MTNEEAISLSYPNPSFSQMACLDLDQDSRGRKSHDMEKRYGPKPIDGVRQVVVIICLLIGLLFSSLDTSIVSTSL
VTISHELNDFANAPWIVLAYLLTYMGFSVCISKLSDIYGRRNMLLLSWTLFMGFSLACASAKSMMMLIWFRALQG
IGASGLYSLTQIGLVEMGPSHRPSLIGAMIGATLAVAFVSGPLLGGVISQLSDWRWIFYINIPCGLVTFMAIASF
WPQEEVAHLLSRKGLSRVDFIGSAALVCSSGCLVYAIQQGGSQSSSWGSPEVIATFVLSGISCVVFVGWEVFLDT
RRFHNVEPIFPMRLMGRRVYVAGLVLTLLTGFPYISLCIIIPERFQIVNGEKALMAGIRILPLLGACAVGSFLGG
ALSSKRNNTSYTLVGASCLQLLGVGLMTTMNGLQASSAAQYGYQAIFGLGVGLSFSAATIMTNMFAAESSVRASA
QGAVAQARVLGGCIGLSVCTVLFNLHINRQLGGTLTKAQLDMLHRSPLTGLGLPEGLKRLVKAVYVGAFGQQIQV
MGLVCAVMVVVSLFSLERYPTPLSAGVMADKDEVSSSRRGSDSGTEIHTITSTRQTV*
Coding >Ophun1|202
ATGACCAACGAGGAAGCCATTTCCCTCTCCTATCCCAACCCATCCTTCAGTCAGATGGCCTGTCTCGACCTGGAC
CAGGACAGCCGAGGGCGCAAGAGCCATGACATGGAGAAGCGATACGGACCCAAGCCCATCGACGGCGTCCGCCAG
GTTGTCGTCATCATCTGTCTTCTCATCGGGCTCTTGTTCTCCAGCCTTGACACCTCCATAGTGTCCACATCCCTG
GTGACGATATCGCACGAGCTCAACGATTTTGCCAATGCCCCCTGGATCGTCCTGGCCTATCTCCTGACGTACATG
GGCTTTTCGGTCTGCATCTCCAAGCTCAGCGACATTTATGGCAGGCGAAACATGCTGCTGCTGTCGTGGACGCTC
TTCATGGGCTTCTCCCTGGCGTGTGCATCGGCCAAGAGCATGATGATGCTCATCTGGTTCCGCGCTCTCCAGGGC
ATCGGCGCCTCCGGCCTGTACTCGTTGACGCAGATCGGGCTCGTCGAGATGGGTCCCAGCCATCGTCCCAGCCTC
ATAGGTGCCATGATAGGGGCCACGCTCGCCGTCGCCTTTGTGTCGGGCCCGCTGCTGGGTGGTGTCATCTCGCAG
CTATCGGACTGGCGATGGATCTTTTACATCAATATTCCCTGTGGATTGGTGACGTTCATGGCCATCGCCAGCTTT
TGGCCGCAGGAAGAGGTCGCTCATCTGCTCTCGCGAAAGGGACTGTCGCGCGTAGACTTCATTGGCAGCGCCGCC
CTCGTCTGCAGCTCGGGCTGTCTCGTCTACGCTATTCAGCAGGGCGGCTCGCAATCATCGTCGTGGGGAAGCCCA
GAGGTGATAGCGACCTTTGTGCTGTCGGGCATCAGCTGTGTCGTCTTTGTCGGCTGGGAGGTGTTTCTCGACACG
AGACGCTTCCACAACGTCGAGCCCATCTTTCCCATGCGTCTGATGGGCCGACGGGTCTATGTCGCCGGCCTGGTG
CTCACGCTTCTCACGGGCTTCCCCTACATCAGCCTCTGCATCATCATCCCGGAGCGCTTCCAGATCGTCAATGGC
GAAAAGGCGCTGATGGCAGGCATCCGCATCCTTCCGCTCCTGGGCGCCTGCGCCGTGGGCTCGTTTCTCGGCGGC
GCGCTGTCGAGCAAACGCAACAACACGTCGTACACGCTCGTGGGCGCCTCGTGTCTCCAGCTGCTGGGTGTCGGG
CTCATGACAACCATGAACGGCCTTCAAGCGAGCTCGGCGGCCCAATACGGCTACCAGGCCATCTTCGGACTCGGC
GTCGGCCTCTCCTTTTCGGCCGCCACCATCATGACCAACATGTTTGCGGCCGAATCGAGCGTGCGGGCGTCGGCA
CAGGGGGCCGTTGCACAAGCCCGGGTCCTGGGCGGCTGTATCGGGCTCTCCGTCTGCACCGTCCTGTTCAACCTG
CACATCAACCGGCAGCTGGGCGGGACCCTGACCAAGGCCCAGCTCGACATGCTGCACCGATCGCCGCTGACGGGC
CTCGGTCTCCCGGAAGGGCTCAAGAGACTGGTCAAGGCCGTGTACGTGGGCGCCTTTGGGCAGCAGATCCAAGTC
ATGGGCCTCGTGTGTGCCGTCATGGTGGTGGTATCGCTCTTTAGCCTCGAGAGGTATCCGACGCCGCTCTCAGCC
GGGGTGATGGCCGACAAGGACGAGGTGTCGTCGTCTCGCCGGGGAAGCGATTCCGGGACGGAGATTCACACGATA
ACGAGCACGCGGCAGACGGTGTAA
Transcript >Ophun1|202
ATGACCAACGAGGAAGCCATTTCCCTCTCCTATCCCAACCCATCCTTCAGTCAGATGGCCTGTCTCGACCTGGAC
CAGGACAGCCGAGGGCGCAAGAGCCATGACATGGAGAAGCGATACGGACCCAAGCCCATCGACGGCGTCCGCCAG
GTTGTCGTCATCATCTGTCTTCTCATCGGGCTCTTGTTCTCCAGCCTTGACACCTCCATAGTGTCCACATCCCTG
GTGACGATATCGCACGAGCTCAACGATTTTGCCAATGCCCCCTGGATCGTCCTGGCCTATCTCCTGACGTACATG
GGCTTTTCGGTCTGCATCTCCAAGCTCAGCGACATTTATGGCAGGCGAAACATGCTGCTGCTGTCGTGGACGCTC
TTCATGGGCTTCTCCCTGGCGTGTGCATCGGCCAAGAGCATGATGATGCTCATCTGGTTCCGCGCTCTCCAGGGC
ATCGGCGCCTCCGGCCTGTACTCGTTGACGCAGATCGGGCTCGTCGAGATGGGTCCCAGCCATCGTCCCAGCCTC
ATAGGTGCCATGATAGGGGCCACGCTCGCCGTCGCCTTTGTGTCGGGCCCGCTGCTGGGTGGTGTCATCTCGCAG
CTATCGGACTGGCGATGGATCTTTTACATCAATATTCCCTGTGGATTGGTGACGTTCATGGCCATCGCCAGCTTT
TGGCCGCAGGAAGAGGTCGCTCATCTGCTCTCGCGAAAGGGACTGTCGCGCGTAGACTTCATTGGCAGCGCCGCC
CTCGTCTGCAGCTCGGGCTGTCTCGTCTACGCTATTCAGCAGGGCGGCTCGCAATCATCGTCGTGGGGAAGCCCA
GAGGTGATAGCGACCTTTGTGCTGTCGGGCATCAGCTGTGTCGTCTTTGTCGGCTGGGAGGTGTTTCTCGACACG
AGACGCTTCCACAACGTCGAGCCCATCTTTCCCATGCGTCTGATGGGCCGACGGGTCTATGTCGCCGGCCTGGTG
CTCACGCTTCTCACGGGCTTCCCCTACATCAGCCTCTGCATCATCATCCCGGAGCGCTTCCAGATCGTCAATGGC
GAAAAGGCGCTGATGGCAGGCATCCGCATCCTTCCGCTCCTGGGCGCCTGCGCCGTGGGCTCGTTTCTCGGCGGC
GCGCTGTCGAGCAAACGCAACAACACGTCGTACACGCTCGTGGGCGCCTCGTGTCTCCAGCTGCTGGGTGTCGGG
CTCATGACAACCATGAACGGCCTTCAAGCGAGCTCGGCGGCCCAATACGGCTACCAGGCCATCTTCGGACTCGGC
GTCGGCCTCTCCTTTTCGGCCGCCACCATCATGACCAACATGTTTGCGGCCGAATCGAGCGTGCGGGCGTCGGCA
CAGGGGGCCGTTGCACAAGCCCGGGTCCTGGGCGGCTGTATCGGGCTCTCCGTCTGCACCGTCCTGTTCAACCTG
CACATCAACCGGCAGCTGGGCGGGACCCTGACCAAGGCCCAGCTCGACATGCTGCACCGATCGCCGCTGACGGGC
CTCGGTCTCCCGGAAGGGCTCAAGAGACTGGTCAAGGCCGTGTACGTGGGCGCCTTTGGGCAGCAGATCCAAGTC
ATGGGCCTCGTGTGTGCCGTCATGGTGGTGGTATCGCTCTTTAGCCTCGAGAGGTATCCGACGCCGCTCTCAGCC
GGGGTGATGGCCGACAAGGACGAGGTGTCGTCGTCTCGCCGGGGAAGCGATTCCGGGACGGAGATTCACACGATA
ACGAGCACGCGGCAGACGGTGTAA
Gene >Ophun1|202
ATGACCAACGAGGAAGCCATTTCCCTCTCCTATCCCAACCCATCCTTCAGTCAGATGGCCTGTCTCGACCTGGAC
CAGGACAGCCGAGGGCGCAAGAGCCATGACATGGAGAAGCGATACGGACCCAAGCCCATCGACGGCGTCCGCCAG
GTTGTCGTCATCATCTGGTATGGACTCAATCCCGCCTCCATCCATCGGCGACGCTGACCCTTTTCCATGCAGTCT
TCTCATCGGGCTCTTGTTCTCCAGCCTTGACACCTCCATAGTGTCCACATCCCTGGTGACGATATCGCACGAGCT
CAACGATTTTGCCAATGCCCCCTGGATCGTCCTGGCCTATCTCCTGACGTACATGGGTCAGTTGACTGCGGAATC
GAGCGAATGTTGGTTGTCTGATGCCGGTTTCTAGGCTTTTCGGTCTGCATCTCCAAGCTCAGCGACATTTATGGC
AGGCGAAACATGCTGCTGCTGTCGTGGACGCTCTTCATGGGCTTCTCCCTGGCGTGTGCATCGGCCAAGAGCATG
ATGATGCTGTAATCGTCGCTGCCACCTTTCAGAGACTGCTCGTCGACTGACAGTGGCCAGCATCTGGTTCCGCGC
TCTCCAGGGCATCGGCGCCTCCGGCCTGTACTCGTTGACGCAGATCGGGCTCGTCGAGATGGGTCCCAGCCATCG
TCCCAGCCTCATAGGTGCCATGATAGGGGCCACGCTCGCCGTCGCCTTTGTGTCGGGCCCGCTGCTGGGTGGTGT
CATCTCGCAGCTATCGGACTGGCGATGGATCTTTTACATCAAGTGAGTCGAGTCAGGGAAGACATGGCAAAGGCG
GACTAACAGACGGCGTCAGTATTCCCTGTGGATTGGTGACGTTCATGGCCATCGCCAGCTTTTGGCCGCAGGAAG
AGGTCGCTCATCTGCTCTCGCGAAAGGGACTGTCGCGCGTAGACTTCATTGGCAGCGCCGCCCTCGTCTGCAGCT
CGGGCTGTCTCGTCTACGCTATTCAGCAGGGCGGCTCGCAATCATCGTCGTGGGGAAGCCCAGAGGTGATAGCGA
CCTTTGTGCTGTCGGGCATCAGCTGTGTCGTCTTTGTCGGCTGGGAGGTGTTTCTCGACACGAGACGCTTCCACA
ACGTCGAGCCCATCTTTCCCATGCGTCTGATGGGCCGACGGGTCTATGTCGCCGGCCTGGTGTACGTCTATCCAT
GAAGAGGGAGCGAGAGGACAGAGTGCTCACTCTTTTCAAGGCTCACGCTTCTCACGGGCTTCCCCTACATCAGCC
TCTGCATCATCATCCCGGAGCGCTTCCAGATCGTCAATGGCGAAAAGGCGCTGATGGCAGGCATCCGCATCCTTC
CGCTCCTGGGCGCCTGCGCCGTGGGCTCGTTTCTCGGCGGCGCGCTGTCGAGCAAACGCAACAACACGTCGTACA
CGCTCGTGGGCGCCTCGTGTCTCCAGCTGCTGGGTGTCGGGCTCATGACAACCATGAACGGCCTTCAAGCGAGCT
CGGCGGCCCAATACGGCTACCAGGCCATCTTCGGACTCGGCGTCGGCCTCTCCTTTTCGGCCGCCACCATCATGA
CCAACATGTTTGCGGCCGAATCGAGCGTGCGGGCGTCGGCACAGGGGGCCGTTGCACAAGCCCGGGTCCTGGGCG
GCTGTATCGGGCTCTCCGTCTGCACCGTCCTGTTCAACCTGCACATCAACCGGCAGCTGGGCGGGACCCTGACCA
AGGCCCAGCTCGACATGCTGCACCGATCGCCGCTGACGGGCCTCGGTCTCCCGGAAGGGCTCAAGAGACTGGTCA
AGGCCGTGTACGTGGGCGCCTTTGGGCAGCAGATCCAAGTCATGGGCCTCGTGTGTGCCGTCATGGTGGTGGTAT
CGCTCTTTAGCCTCGAGAGGTATCCGACGCCGCTCTCAGCCGGGGTGATGGCCGACAAGGACGAGGTGTCGTCGT
CTCGCCGGGGAAGCGATTCCGGGACGGAGATTCACACGATAACGAGCACGCGGCAGACGGTGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail