Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2017
Gene name
LocationContig_193:11756..13910
Strand-
Gene length (bp)2154
Transcript length (bp)1794
Coding sequence length (bp)1794
Protein length (aa) 598

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16275 SF1-HH Splicing factor 1 helix-hairpin domain 7.4E-43 57 166
PF00098 zf-CCHC Zinc knuckle 1.9E-04 295 310
PF00098 zf-CCHC Zinc knuckle 1.4E-05 320 335
PF00013 KH_1 KH domain 2.8E-07 186 257

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4WXV6|BBP_ASPFU Branchpoint-bridging protein OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=bbp PE=3 SV=1 1 470 0.0E+00
sp|Q8NIW7|BBP_NEUCR Branchpoint-bridging protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=bbp-1 PE=3 SV=1 1 440 0.0E+00
sp|O74555|BBP_SCHPO Branchpoint-bridging protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bpb1 PE=1 SV=1 4 381 6.0E-147
sp|P0CO44|BBP_CRYNJ Branchpoint-bridging protein OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=BBP PE=3 SV=1 36 385 2.0E-120
sp|P0CO45|BBP_CRYNB Branchpoint-bridging protein OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=BBP PE=3 SV=1 36 385 2.0E-120
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4WXV6|BBP_ASPFU Branchpoint-bridging protein OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=bbp PE=3 SV=1 1 470 0.0E+00
sp|Q8NIW7|BBP_NEUCR Branchpoint-bridging protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=bbp-1 PE=3 SV=1 1 440 0.0E+00
sp|O74555|BBP_SCHPO Branchpoint-bridging protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bpb1 PE=1 SV=1 4 381 6.0E-147
sp|P0CO44|BBP_CRYNJ Branchpoint-bridging protein OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=BBP PE=3 SV=1 36 385 2.0E-120
sp|P0CO45|BBP_CRYNB Branchpoint-bridging protein OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=BBP PE=3 SV=1 36 385 2.0E-120
sp|Q6C187|BBP_YARLI Branchpoint-bridging protein OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=BBP PE=3 SV=1 9 380 5.0E-116
sp|Q4P0H7|BBP_USTMA Branchpoint-bridging protein OS=Ustilago maydis (strain 521 / FGSC 9021) GN=BBP PE=3 SV=1 54 379 3.0E-113
sp|Q12186|BBP_YEAST Branchpoint-bridging protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MSL5 PE=1 SV=1 73 334 7.0E-98
sp|Q750X2|BBP_ASHGO Branchpoint-bridging protein OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=BBP PE=3 SV=2 62 364 3.0E-92
sp|Q6FW77|BBP_CANGA Branchpoint-bridging protein OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=BBP PE=3 SV=1 74 412 8.0E-92
sp|Q15637|SF01_HUMAN Splicing factor 1 OS=Homo sapiens GN=SF1 PE=1 SV=4 49 388 9.0E-81
sp|Q64213|SF01_MOUSE Splicing factor 1 OS=Mus musculus GN=Sf1 PE=1 SV=6 49 388 1.0E-80
sp|Q5AED9|BBP_CANAL Branchpoint-bridging protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=BBP PE=3 SV=1 54 334 4.0E-76
sp|Q6BSP4|BBP_DEBHA Branchpoint-bridging protein OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=BBP PE=3 SV=2 45 347 2.0E-70
sp|Q54BM5|BBP_DICDI Branchpoint-bridging protein OS=Dictyostelium discoideum GN=sf1 PE=3 SV=1 22 349 7.0E-61
sp|Q32NN2|QKIA_XENLA Protein quaking-A OS=Xenopus laevis GN=qki-a PE=1 SV=2 169 290 6.0E-23
sp|Q91XU1|QKI_RAT Protein quaking OS=Rattus norvegicus GN=Qki PE=1 SV=2 169 290 6.0E-23
sp|Q6P104|QKIB_DANRE Protein quaking-B OS=Danio rerio GN=qkib PE=2 SV=1 170 290 6.0E-23
sp|Q5W9D7|QKI_BOVIN Protein quaking OS=Bos taurus GN=QKI PE=2 SV=1 169 290 6.0E-23
sp|Q9GMY1|QKI_CANLF Protein quaking OS=Canis lupus familiaris GN=QKI PE=2 SV=1 169 290 6.0E-23
sp|Q5W9D6|QKI_HORSE Protein quaking OS=Equus caballus GN=QKI PE=2 SV=1 169 290 6.0E-23
sp|Q96PU8|QKI_HUMAN Protein quaking OS=Homo sapiens GN=QKI PE=1 SV=1 169 290 6.0E-23
sp|Q9QYS9|QKI_MOUSE Protein quaking OS=Mus musculus GN=Qki PE=1 SV=1 169 290 6.0E-23
sp|Q5W9D5|QKI_PIG Protein quaking OS=Sus scrofa GN=QKI PE=2 SV=1 169 290 6.0E-23
sp|Q7JJZ8|QKI_FELCA Protein quaking OS=Felis catus GN=QKI PE=2 SV=1 169 290 6.0E-23
sp|Q9YH18|QKI_CHICK Protein quaking OS=Gallus gallus GN=QKI PE=2 SV=2 169 290 7.0E-23
sp|Q6IRN2|QKIB_XENLA Protein quaking-B OS=Xenopus laevis GN=qki-b PE=1 SV=1 169 290 8.0E-23
sp|Q17339|GLD1_CAEEL Female germline-specific tumor suppressor gld-1 OS=Caenorhabditis elegans GN=gld-1 PE=1 SV=1 173 289 2.0E-22
sp|O01367|HOW_DROME Protein held out wings OS=Drosophila melanogaster GN=how PE=1 SV=1 173 318 9.0E-22
sp|Q6P0D0|QKIA_DANRE Protein quaking-A OS=Danio rerio GN=qkia PE=2 SV=2 172 295 5.0E-21
sp|Q8GYR4|QKIL4_ARATH KH domain-containing protein At3g08620 OS=Arabidopsis thaliana GN=At3g08620 PE=2 SV=1 168 291 7.0E-21
sp|Q75GR5|SPIN1_ORYSJ KH domain-containing protein SPIN1 OS=Oryza sativa subsp. japonica GN=SPIN1 PE=1 SV=1 161 291 8.0E-20
sp|Q9ZVI3|QKIL3_ARATH KH domain-containing protein At2g38610 OS=Arabidopsis thaliana GN=At2g38610 PE=1 SV=1 169 291 2.0E-19
sp|Q8GWR3|QKIL5_ARATH KH domain-containing protein At1g09660/At1g09670 OS=Arabidopsis thaliana GN=At1g09660 PE=2 SV=1 169 291 3.0E-18
sp|Q08BJ2|KHDR2_DANRE KH domain-containing, RNA-binding, signal transduction-associated protein 2 OS=Danio rerio GN=khdrbs2 PE=2 SV=1 169 287 5.0E-18
sp|Q0VFL3|KHDR2_XENTR KH domain-containing, RNA-binding, signal transduction-associated protein 2 OS=Xenopus tropicalis GN=khdrbs2 PE=2 SV=1 169 287 7.0E-18
sp|Q5VWX1|KHDR2_HUMAN KH domain-containing, RNA-binding, signal transduction-associated protein 2 OS=Homo sapiens GN=KHDRBS2 PE=1 SV=1 169 287 2.0E-17
sp|Q9WU01|KHDR2_MOUSE KH domain-containing, RNA-binding, signal transduction-associated protein 2 OS=Mus musculus GN=Khdrbs2 PE=1 SV=1 169 287 2.0E-17
sp|Q920F3|KHDR2_RAT KH domain-containing, RNA-binding, signal transduction-associated protein 2 OS=Rattus norvegicus GN=Khdrbs2 PE=1 SV=1 169 287 4.0E-17
sp|Q9FKT4|QKIL2_ARATH KH domain-containing protein At5g56140 OS=Arabidopsis thaliana GN=At5g56140 PE=2 SV=1 170 291 4.0E-17
sp|Q0WLR1|QKIL1_ARATH KH domain-containing protein At4g26480 OS=Arabidopsis thaliana GN=At4g26480 PE=2 SV=1 169 291 2.0E-16
sp|Q9JLP1|KHDR3_RAT KH domain-containing, RNA-binding, signal transduction-associated protein 3 OS=Rattus norvegicus GN=Khdrbs3 PE=1 SV=1 118 286 2.0E-14
sp|Q9R226|KHDR3_MOUSE KH domain-containing, RNA-binding, signal transduction-associated protein 3 OS=Mus musculus GN=Khdrbs3 PE=1 SV=1 118 286 2.0E-14
sp|O75525|KHDR3_HUMAN KH domain-containing, RNA-binding, signal transduction-associated protein 3 OS=Homo sapiens GN=KHDRBS3 PE=1 SV=1 170 286 3.0E-14
sp|Q07666|KHDR1_HUMAN KH domain-containing, RNA-binding, signal transduction-associated protein 1 OS=Homo sapiens GN=KHDRBS1 PE=1 SV=1 169 287 3.0E-13
sp|Q91V33|KHDR1_RAT KH domain-containing, RNA-binding, signal transduction-associated protein 1 OS=Rattus norvegicus GN=Khdrbs1 PE=1 SV=1 169 287 4.0E-13
sp|Q60749|KHDR1_MOUSE KH domain-containing, RNA-binding, signal transduction-associated protein 1 OS=Mus musculus GN=Khdrbs1 PE=1 SV=2 169 287 5.0E-13
sp|Q8UUW7|KHDR1_CHICK KH domain-containing, RNA-binding, signal transduction-associated protein 1 OS=Gallus gallus GN=KHDRBS1 PE=2 SV=1 169 287 7.0E-13
sp|P13230|GRP33_ARTSA Glycine-rich protein GRP33 OS=Artemia salina PE=2 SV=1 154 243 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0008270 zinc ion binding Yes
GO:0003723 RNA binding Yes
GO:0003676 nucleic acid binding Yes
GO:0097159 organic cyclic compound binding No
GO:0046872 metal ion binding No
GO:0046914 transition metal ion binding No
GO:0003674 molecular_function No
GO:1901363 heterocyclic compound binding No
GO:0043167 ion binding No
GO:0005488 binding No
GO:0043169 cation binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Zinc finger, CCHC-type

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2845
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5688
Ophiocordyceps australis map64 (Brazil) OphauB2|6247
Ophiocordyceps camponoti-rufipedis Ophun1|2017 (this protein)
Ophiocordyceps kimflemingae Ophio5|8333
Ophiocordyceps subramaniannii Hirsu2|4653
Ophiocordyceps subramaniannii Hirsu2|9621

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2017
MAWRNQGITGSNNIPLGKSRRFGGEAEDDGYERGDHKRGRDPEPRGEGDEPRRRKKRNRWAEASENKAAGLMGLP
TAILSNMTSEQLEAYTLHLRIEEISQKLRIDDVVPADGDRSPSPPPSYDNHGRRINTREYRYRKRLEDERHKLVE
RAMKTIPNYHPPQDYRRPTKTQEKVYVPVNDYPEINFIGLLIGPRGNTLKKMEADSGAKIAIRGKGSVKEGKGRS
DAAHSSNQEEDLHCLIMADTEEKINKAKQLIHNVIETAASIPEGQNELKRNQLRELAALNGTLRDDENQACQNCG
RIGHRKYDCPDRQNYTASIICRVCGNAGHMARDCPDRQRGASWRNNDSNGGRHAGRIGGPPGSGDAVDREMEQLM
QELGGGPSAPARIEAGPGGHGGHGGHGGHGGHGGHGGHDDGDVKPWQRGPSGGGGPAPWRSRQHDGHDGPAGGGG
GSGGAGGGGGGGGGGAGGSGGGGPAPWARERNRGHDQHGGNSGHYGQHGDGHHDYSYGSGAGGPPGWHQAAPGTQ
GGYGGYGYNNYGGPPGMGSSPGPPPGLAPSDGHRGSFQQYPGAPPPPSLPRSGNSPPPPPSNQPPPPPPPGA*
Coding >Ophun1|2017
ATGGCGTGGAGAAATCAGGGCATCACGGGTTCCAACAACATCCCGCTCGGAAAGTCGCGGCGCTTCGGCGGGGAG
GCTGAGGACGATGGCTACGAACGCGGCGATCATAAGCGCGGTCGTGATCCTGAGCCCCGTGGCGAGGGGGATGAG
CCTCGTCGGCGCAAGAAACGGAATCGCTGGGCTGAAGCGTCGGAGAATAAAGCTGCTGGTCTGATGGGCCTTCCC
ACCGCCATTCTTTCCAACATGACGAGCGAGCAGCTTGAGGCCTATACCCTTCACCTTCGCATCGAGGAGATCAGT
CAAAAACTTAGGATTGATGACGTTGTCCCTGCTGACGGTGATCGGTCGCCTTCTCCCCCGCCTAGTTATGACAAC
CATGGGCGGCGTATCAACACGCGCGAGTATCGCTATCGCAAGCGACTCGAAGACGAGCGACACAAGCTCGTCGAG
CGGGCCATGAAAACGATTCCGAATTATCATCCACCCCAGGACTACCGACGTCCTACCAAGACCCAGGAGAAAGTC
TACGTGCCGGTTAATGATTATCCGGAAATCAACTTCATCGGTCTACTCATCGGTCCCCGTGGCAATACCCTCAAG
AAAATGGAAGCCGATTCGGGTGCCAAGATTGCGATTCGCGGAAAGGGCTCCGTCAAGGAGGGTAAAGGGCGCTCC
GACGCTGCCCATTCCAGCAACCAAGAAGAGGATCTCCACTGCCTCATCATGGCAGACACGGAGGAGAAGATCAAC
AAAGCCAAGCAGTTGATCCACAACGTCATAGAGACGGCTGCCTCTATCCCGGAAGGGCAAAACGAGCTCAAGCGC
AATCAGCTCCGAGAACTAGCTGCGCTCAACGGAACGCTGCGTGATGACGAGAACCAGGCTTGCCAGAACTGCGGA
AGGATTGGTCATCGCAAGTATGACTGCCCCGACAGGCAAAACTACACGGCCAGCATCATCTGTCGAGTCTGCGGC
AACGCCGGCCATATGGCGCGCGACTGTCCCGACCGTCAGAGGGGTGCCAGCTGGCGCAACAACGACTCCAACGGC
GGACGTCATGCCGGAAGAATCGGCGGTCCTCCCGGCAGCGGTGATGCTGTTGATCGCGAGATGGAGCAACTCATG
CAAGAACTCGGCGGAGGCCCTAGCGCACCTGCTCGGATCGAAGCTGGACCGGGTGGCCATGGTGGTCACGGCGGA
CATGGCGGACATGGCGGCCATGGCGGTCACGGTGGCCACGATGATGGCGACGTCAAGCCTTGGCAACGCGGCCCG
TCCGGCGGCGGTGGACCTGCTCCTTGGCGCTCGCGTCAACACGACGGCCACGATGGACCGGCTGGCGGCGGCGGC
GGCAGCGGTGGTGCTGGAGGTGGCGGTGGCGGCGGTGGTGGTGGTGCTGGAGGTAGCGGCGGCGGCGGTCCCGCT
CCTTGGGCCCGCGAGCGCAACCGCGGTCACGACCAGCACGGCGGCAACTCGGGTCACTACGGACAGCACGGCGAC
GGCCATCACGACTACTCGTACGGCTCCGGCGCTGGAGGACCCCCGGGCTGGCACCAGGCTGCTCCCGGCACGCAG
GGCGGCTACGGCGGCTACGGCTACAACAACTATGGCGGCCCTCCCGGAATGGGTTCTTCTCCTGGCCCGCCTCCC
GGCCTCGCCCCCTCTGACGGACATCGCGGATCGTTCCAGCAGTATCCCGGCGCGCCTCCTCCGCCTTCGCTCCCG
CGGTCTGGCAATTCGCCCCCGCCGCCTCCCAGCAACCAGCCGCCGCCTCCTCCCCCCCCCGGCGCATAG
Transcript >Ophun1|2017
ATGGCGTGGAGAAATCAGGGCATCACGGGTTCCAACAACATCCCGCTCGGAAAGTCGCGGCGCTTCGGCGGGGAG
GCTGAGGACGATGGCTACGAACGCGGCGATCATAAGCGCGGTCGTGATCCTGAGCCCCGTGGCGAGGGGGATGAG
CCTCGTCGGCGCAAGAAACGGAATCGCTGGGCTGAAGCGTCGGAGAATAAAGCTGCTGGTCTGATGGGCCTTCCC
ACCGCCATTCTTTCCAACATGACGAGCGAGCAGCTTGAGGCCTATACCCTTCACCTTCGCATCGAGGAGATCAGT
CAAAAACTTAGGATTGATGACGTTGTCCCTGCTGACGGTGATCGGTCGCCTTCTCCCCCGCCTAGTTATGACAAC
CATGGGCGGCGTATCAACACGCGCGAGTATCGCTATCGCAAGCGACTCGAAGACGAGCGACACAAGCTCGTCGAG
CGGGCCATGAAAACGATTCCGAATTATCATCCACCCCAGGACTACCGACGTCCTACCAAGACCCAGGAGAAAGTC
TACGTGCCGGTTAATGATTATCCGGAAATCAACTTCATCGGTCTACTCATCGGTCCCCGTGGCAATACCCTCAAG
AAAATGGAAGCCGATTCGGGTGCCAAGATTGCGATTCGCGGAAAGGGCTCCGTCAAGGAGGGTAAAGGGCGCTCC
GACGCTGCCCATTCCAGCAACCAAGAAGAGGATCTCCACTGCCTCATCATGGCAGACACGGAGGAGAAGATCAAC
AAAGCCAAGCAGTTGATCCACAACGTCATAGAGACGGCTGCCTCTATCCCGGAAGGGCAAAACGAGCTCAAGCGC
AATCAGCTCCGAGAACTAGCTGCGCTCAACGGAACGCTGCGTGATGACGAGAACCAGGCTTGCCAGAACTGCGGA
AGGATTGGTCATCGCAAGTATGACTGCCCCGACAGGCAAAACTACACGGCCAGCATCATCTGTCGAGTCTGCGGC
AACGCCGGCCATATGGCGCGCGACTGTCCCGACCGTCAGAGGGGTGCCAGCTGGCGCAACAACGACTCCAACGGC
GGACGTCATGCCGGAAGAATCGGCGGTCCTCCCGGCAGCGGTGATGCTGTTGATCGCGAGATGGAGCAACTCATG
CAAGAACTCGGCGGAGGCCCTAGCGCACCTGCTCGGATCGAAGCTGGACCGGGTGGCCATGGTGGTCACGGCGGA
CATGGCGGACATGGCGGCCATGGCGGTCACGGTGGCCACGATGATGGCGACGTCAAGCCTTGGCAACGCGGCCCG
TCCGGCGGCGGTGGACCTGCTCCTTGGCGCTCGCGTCAACACGACGGCCACGATGGACCGGCTGGCGGCGGCGGC
GGCAGCGGTGGTGCTGGAGGTGGCGGTGGCGGCGGTGGTGGTGGTGCTGGAGGTAGCGGCGGCGGCGGTCCCGCT
CCTTGGGCCCGCGAGCGCAACCGCGGTCACGACCAGCACGGCGGCAACTCGGGTCACTACGGACAGCACGGCGAC
GGCCATCACGACTACTCGTACGGCTCCGGCGCTGGAGGACCCCCGGGCTGGCACCAGGCTGCTCCCGGCACGCAG
GGCGGCTACGGCGGCTACGGCTACAACAACTATGGCGGCCCTCCCGGAATGGGTTCTTCTCCTGGCCCGCCTCCC
GGCCTCGCCCCCTCTGACGGACATCGCGGATCGTTCCAGCAGTATCCCGGCGCGCCTCCTCCGCCTTCGCTCCCG
CGGTCTGGCAATTCGCCCCCGCCGCCTCCCAGCAACCAGCCGCCGCCTCCTCCCCCCCCCGGCGCATAG
Gene >Ophun1|2017
ATGGCGTGGAGAAATCAGGGCATCACGGGTTCCAACAACATCCCGCTCGGAAAGTCGCGGCGCTTCGGCGGGGAG
GCTGAGGACGATGGCTACGAACGCGGCGATCATAAGCGCGGTCGTGATCCTGAGCCCCGTGGCGAGGGGGATGAG
CCTCGTCGGCGCAAGAAACGGAATCGCTGGGCTGAAGCGTCGGAGAATAAAGCTGCTGGTCTGATGGGCCTTCCC
ACCGCCATTCTTTCCAACATGACGAGCGAGCAGCTTGAGGCCTATACCCTTCACCTTCGCATCGAGGAGATCAGT
CAAAAACTTAGGATTGATGACGTTGTCCCTGCTGACGGTGATCGGTGAGTCCTATTTCATTTTCTCTTTGCCTTT
TATTTGTGGAAGTTCCGCTTTGCTGATTTTGTCCTCTTTTTTCAGGTCGCCTTCTCCCCCGCCTAGTTATGACAA
CCATGGGCGGCGTATCAACACGCGCGAGTATCGCTATCGCAAGCGACTCGAAGACGAGCGACACAAGCTCGTCGA
GCGGGCCATGAAAACGATTCCGAATTATCATCCACCCCAGGACTACCGACGTCCTACCAAGACCCAGGAGAAAGT
CTACGTGCCGGTTAATGATTATCCGGAAATCAACTTCAGTATGATTGCAAATCCCCCTCCCCTTTCCCTTTCCTT
TCTCGTTTCTGTTCATCACATGTGCATCAGGTTCTTGTTCACTCACTCGTTTCCCTACTTACTGCATCCTCGCTT
CGGGGTTCGCCCCGGTCATCTAACTTTAAACACCTGAGAGACCTTTGCTAACATCTAGGTTCAAGTCGGTCTACT
CATCGGTCCCCGTGGCAATACCCTCAAGAAAATGGAAGCCGATTCGGGTGCCAAGATTGCGATTCGCGGAAAGGG
CTCCGTCAAGGAGGGTAAAGGGCGCTCCGACGCTGCCCATTCCAGCAACCAAGAAGAGGATCTCCACTGCCTCAT
CATGGCAGACACGGAGGAGAAGATCAACAAAGCCAAGCAGTTGATCCACAACGTCATAGAGACGGTGAGTTTTTG
TTACCTTGCGAACATGTCCGCTTCATCTAACTTTACTTGCCAGGCTGCCTCTATCCCGGAAGGGCAAAACGAGCT
CAAGCGCAATCAGCTCCGAGAACTAGCTGCGCTCAACGGAACGCTGCGTGATGACGAGAACCAGGCTTGCCAGAA
CTGCGGAAGGATTGGTCATCGCAAGTATGACTGCCCCGACAGGCAAAACTACACGGCCAGCATCATCTGTCGAGT
CTGCGGCAACGCCGGCCATATGGCGCGCGACTGTCCCGACCGTCAGAGGGGTGCCAGCTGGCGCAACAACGACTC
CAACGGCGGACGTCATGCCGGAAGAATCGGCGGTCCTCCCGGCAGCGGTGATGCTGTTGATCGCGAGATGGAGGT
ACGTCTCGTTTCATACGACGAGCGCTAGAACTTGGCTGACGATGACTCTAGCAACTCATGCAAGAACTCGGCGGA
GGCCCTAGCGCACCTGCTCGGATCGAAGCTGGACCGGGTGGCCATGGTGGTCACGGCGGACATGGCGGACATGGC
GGCCATGGCGGTCACGGTGGCCACGATGATGGCGACGTCAAGCCTTGGCAACGCGGCCCGTCCGGCGGCGGTGGA
CCTGCTCCTTGGCGCTCGCGTCAACACGACGGCCACGATGGACCGGCTGGCGGCGGCGGCGGCAGCGGTGGTGCT
GGAGGTGGCGGTGGCGGCGGTGGTGGTGGTGCTGGAGGTAGCGGCGGCGGCGGTCCCGCTCCTTGGGCCCGCGAG
CGCAACCGCGGTCACGACCAGCACGGCGGCAACTCGGGTCACTACGGACAGCACGGCGACGGCCATCACGACTAC
TCGTACGGCTCCGGCGCTGGAGGACCCCCGGGCTGGCACCAGGCTGCTCCCGGCACGCAGGGCGGCTACGGCGGC
TACGGCTACAACAACTATGGCGGCCCTCCCGGAATGGGTTCTTCTCCTGGCCCGCCTCCCGGCCTCGCCCCCTCT
GACGGACATCGCGGATCGTTCCAGCAGTATCCCGGCGCGCCTCCTCCGCCTTCGCTCCCGCGGTCTGGCAATTCG
CCCCCGCCGCCTCCCAGCAACCAGCCGCCGCCTCCTCCCCCCCCCGGCGCATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail