Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2015
Gene name
LocationContig_193:6724..7294
Strand+
Gene length (bp)570
Transcript length (bp)477
Coding sequence length (bp)477
Protein length (aa) 159

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05730 CFEM CFEM domain 1.7E-09 20 85

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 17 0.999733

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup534
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5692
Ophiocordyceps australis map64 (Brazil) OphauB2|6244
Ophiocordyceps camponoti-floridani Ophcf2|03044
Ophiocordyceps camponoti-rufipedis Ophun1|2015 (this protein)
Ophiocordyceps kimflemingae Ophio5|8335
Ophiocordyceps subramaniannii Hirsu2|3333

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2015
MHFSTTTLLSLLTLASADSLSNIPPCAQSCVRDAVTGHTQCDLDSLSCICNSVKTVLPTAAECVIENCTTDQIFN
EVLPNAFQTCGSYANQLAARQANVQCVPVAVEPVVSTATAQPHVVTTTVRAGPSPTAPVVTAGAAAGVAPGGLAA
LAVAAVLL*
Coding >Ophun1|2015
ATGCACTTCTCAACAACCACACTCCTCTCCCTCCTCACCCTCGCCTCCGCCGACTCCCTCAGCAACATCCCCCCC
TGCGCCCAATCCTGCGTCCGCGACGCCGTCACAGGCCACACCCAGTGCGACCTCGACTCCCTCTCCTGCATCTGC
AACAGCGTCAAGACGGTCCTCCCCACCGCCGCAGAGTGCGTCATCGAGAACTGCACCACCGACCAAATCTTCAAC
GAGGTCCTCCCCAACGCCTTCCAGACCTGCGGCTCCTACGCCAACCAGCTCGCCGCCCGCCAAGCCAACGTCCAG
TGCGTGCCCGTGGCCGTCGAGCCCGTCGTCTCCACCGCCACGGCGCAGCCCCACGTCGTCACCACCACCGTCCGG
GCCGGCCCCTCGCCCACCGCCCCCGTCGTCACCGCCGGGGCTGCGGCGGGTGTGGCGCCCGGGGGGTTGGCGGCT
TTGGCCGTTGCGGCTGTTCTTCTGTAG
Transcript >Ophun1|2015
ATGCACTTCTCAACAACCACACTCCTCTCCCTCCTCACCCTCGCCTCCGCCGACTCCCTCAGCAACATCCCCCCC
TGCGCCCAATCCTGCGTCCGCGACGCCGTCACAGGCCACACCCAGTGCGACCTCGACTCCCTCTCCTGCATCTGC
AACAGCGTCAAGACGGTCCTCCCCACCGCCGCAGAGTGCGTCATCGAGAACTGCACCACCGACCAAATCTTCAAC
GAGGTCCTCCCCAACGCCTTCCAGACCTGCGGCTCCTACGCCAACCAGCTCGCCGCCCGCCAAGCCAACGTCCAG
TGCGTGCCCGTGGCCGTCGAGCCCGTCGTCTCCACCGCCACGGCGCAGCCCCACGTCGTCACCACCACCGTCCGG
GCCGGCCCCTCGCCCACCGCCCCCGTCGTCACCGCCGGGGCTGCGGCGGGTGTGGCGCCCGGGGGGTTGGCGGCT
TTGGCCGTTGCGGCTGTTCTTCTGTAG
Gene >Ophun1|2015
ATGCACTTCTCAACAACCACACTCCTCTCCCTCCTCACCCTCGCCTCCGCCGACTCCCTCAGCAACATCCCCCCC
TGCGCCCAATCCTGCGTCCGCGACGCCGTCACAGGCCACACCCAGTGCGACCTCGACTCCCTCTCCTGCATCTGC
AACAGCGTCAAGACGGTCCTCCCCACCGCCGCAGAGTGCGTCATCGAGAACTGCACCACCGACCAAATCTTCAGT
AACTCCCCCCCAATCTCATCCCCTTTCTTCGTCCCCCTTCCCTCCCCTTTCCCATCCCTACAAGTACCTGAGAAA
GCTAACGGTTCGACAGACGAGGTCCTCCCCAACGCCTTCCAGACCTGCGGCTCCTACGCCAACCAGCTCGCCGCC
CGCCAAGCCAACGTCCAGTGCGTGCCCGTGGCCGTCGAGCCCGTCGTCTCCACCGCCACGGCGCAGCCCCACGTC
GTCACCACCACCGTCCGGGCCGGCCCCTCGCCCACCGCCCCCGTCGTCACCGCCGGGGCTGCGGCGGGTGTGGCG
CCCGGGGGGTTGGCGGCTTTGGCCGTTGCGGCTGTTCTTCTGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail