Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2011
Gene name
LocationContig_1920:191..1276
Strand+
Gene length (bp)1085
Transcript length (bp)1029
Coding sequence length (bp)1029
Protein length (aa) 343

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01805 Surp Surp module 1.7E-12 3 55

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0006396 RNA processing Yes
GO:0003723 RNA binding Yes
GO:0090304 nucleic acid metabolic process No
GO:0044237 cellular metabolic process No
GO:0044238 primary metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0009987 cellular process No
GO:0008152 metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0006725 cellular aromatic compound metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0003674 molecular_function No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0005488 binding No
GO:0008150 biological_process No
GO:0003676 nucleic acid binding No
GO:1901360 organic cyclic compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0016070 RNA metabolic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1683
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5532
Ophiocordyceps australis map64 (Brazil) OphauB2|7094
Ophiocordyceps camponoti-floridani Ophcf2|01208
Ophiocordyceps camponoti-rufipedis Ophun1|2011 (this protein)
Ophiocordyceps kimflemingae Ophio5|5595
Ophiocordyceps subramaniannii Hirsu2|1455

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2011
MLRLIHTTVERVLEHGPEFEALLMSRPEVQREEKWAWLWDSRSAGGVWYRWRLWQLTTGYKANPKREPHVGIFED
SPPWQVPEPLPFEFVSQLDEFVSDADYNSSDDEDMDRDGNRENNASDLERPFLAPLDKAKLVHLLARLPVSLTKL
RKGDLAKVTSFALMHADRGPTEVVDLIVSNIGKPFALTGANTENNTETRQATEEGAAAEGLDTSTASLIGLYMVS
DILSSSSTTVFRHAWRFRSLFEKALKDFQVFEFLGIMPEKQGWGRMRAEKWKRSIRLVLNLWEGWCVFQGKAFEH
FVSAFDKPPSVKTDDASSKEKLEARAKVEAVERKVEVREAGG*
Coding >Ophun1|2011
ATGCTGCGTCTGATTCACACCACAGTCGAGCGCGTTCTCGAGCACGGGCCCGAATTTGAGGCTCTCCTCATGTCG
AGGCCCGAGGTTCAGCGCGAGGAGAAATGGGCCTGGCTCTGGGACTCGAGAAGCGCGGGCGGCGTCTGGTACCGC
TGGCGACTCTGGCAACTCACGACTGGATACAAGGCCAATCCGAAACGGGAGCCTCACGTTGGCATCTTCGAGGAC
AGCCCTCCCTGGCAGGTTCCCGAACCGTTGCCATTTGAATTCGTCAGTCAGCTTGACGAGTTCGTTTCCGACGCA
GACTATAATTCCTCGGACGACGAGGACATGGACCGCGATGGCAACCGCGAGAACAATGCGAGCGACCTGGAGCGA
CCCTTTCTCGCCCCATTGGACAAGGCCAAGCTCGTCCACCTCTTGGCTCGACTTCCGGTGAGTCTGACCAAACTA
CGCAAAGGAGACCTTGCCAAGGTTACATCTTTTGCGCTCATGCACGCCGACCGAGGCCCGACCGAGGTCGTCGAC
CTGATCGTCTCCAACATTGGAAAGCCCTTTGCCTTGACGGGTGCCAACACGGAGAACAATACCGAGACACGACAA
GCCACGGAAGAAGGGGCGGCAGCAGAGGGACTGGACACGAGCACGGCCAGCCTGATAGGTTTGTACATGGTCAGC
GACATCCTGTCGTCTTCGTCGACGACCGTCTTCCGACACGCTTGGAGGTTCCGAAGCCTATTCGAGAAGGCGCTG
AAGGATTTCCAGGTGTTTGAGTTCTTGGGCATCATGCCTGAGAAGCAAGGCTGGGGGCGAATGCGAGCAGAGAAG
TGGAAACGCAGCATCAGACTCGTTCTGAATTTGTGGGAAGGGTGGTGCGTGTTTCAAGGCAAGGCATTTGAGCAC
TTTGTTTCGGCGTTTGACAAGCCACCGTCGGTCAAGACGGACGACGCATCGAGCAAGGAAAAGTTGGAGGCTCGG
GCGAAGGTGGAAGCGGTGGAGCGCAAAGTGGAGGTGAGAGAAGCCGGTGGATGA
Transcript >Ophun1|2011
ATGCTGCGTCTGATTCACACCACAGTCGAGCGCGTTCTCGAGCACGGGCCCGAATTTGAGGCTCTCCTCATGTCG
AGGCCCGAGGTTCAGCGCGAGGAGAAATGGGCCTGGCTCTGGGACTCGAGAAGCGCGGGCGGCGTCTGGTACCGC
TGGCGACTCTGGCAACTCACGACTGGATACAAGGCCAATCCGAAACGGGAGCCTCACGTTGGCATCTTCGAGGAC
AGCCCTCCCTGGCAGGTTCCCGAACCGTTGCCATTTGAATTCGTCAGTCAGCTTGACGAGTTCGTTTCCGACGCA
GACTATAATTCCTCGGACGACGAGGACATGGACCGCGATGGCAACCGCGAGAACAATGCGAGCGACCTGGAGCGA
CCCTTTCTCGCCCCATTGGACAAGGCCAAGCTCGTCCACCTCTTGGCTCGACTTCCGGTGAGTCTGACCAAACTA
CGCAAAGGAGACCTTGCCAAGGTTACATCTTTTGCGCTCATGCACGCCGACCGAGGCCCGACCGAGGTCGTCGAC
CTGATCGTCTCCAACATTGGAAAGCCCTTTGCCTTGACGGGTGCCAACACGGAGAACAATACCGAGACACGACAA
GCCACGGAAGAAGGGGCGGCAGCAGAGGGACTGGACACGAGCACGGCCAGCCTGATAGGTTTGTACATGGTCAGC
GACATCCTGTCGTCTTCGTCGACGACCGTCTTCCGACACGCTTGGAGGTTCCGAAGCCTATTCGAGAAGGCGCTG
AAGGATTTCCAGGTGTTTGAGTTCTTGGGCATCATGCCTGAGAAGCAAGGCTGGGGGCGAATGCGAGCAGAGAAG
TGGAAACGCAGCATCAGACTCGTTCTGAATTTGTGGGAAGGGTGGTGCGTGTTTCAAGGCAAGGCATTTGAGCAC
TTTGTTTCGGCGTTTGACAAGCCACCGTCGGTCAAGACGGACGACGCATCGAGCAAGGAAAAGTTGGAGGCTCGG
GCGAAGGTGGAAGCGGTGGAGCGCAAAGTGGAGGTGAGAGAAGCCGGTGGATGA
Gene >Ophun1|2011
ATGCTGCGTCTGATTCACACCACAGTCGAGCGCGTTCTCGAGCACGGGCCCGAATTTGAGGCTCTCCTCATGTCG
AGGCCCGAGGTTCAGCGCGAGGAGAAATGGGCCTGGCTCTGGGACTCGAGAAGCGCGGGCGGCGTCTGGTACCGC
TGGCGACTCTGGCAACTCACGACTGGATACAAGGCCAATCCGAAACGGGAGCCTCACGTTGGCATCTTCGAGGAC
AGCCCTCCCTGGCAGGTTCCCGAACCGTTGCCATTTGAATTCGTCAGTCAGCTTGACGAGTTCGTTTCCGACGCA
GACTATAATTCCTCGGACGACGAGGACATGGACCGCGATGGCAACCGCGAGAACAATGCGAGCGACCTGGAGCGA
CCCTTTCTCGCCCCATTGGACAAGGCCAAGCTCGTCCACCTCTTGGCTCGACTTCCGGTGAGTCTGACCAAACTA
CGCAAAGGAGACCTTGCCAAGGTTACATCTTTTGCGCTCATGCACGCCGACCGAGGCCCGACCGAGGTCGTCGAC
CTGATCGTCTCCAACATTGGAAAGCCCTTTGCCTTGACGGGTGCCAACACGGAGAACAATACCGAGACACGACAA
GCCACGGAAGAAGGGGCGGCAGCAGAGGGACTGGACACGAGCACGGCCAGCCTGATAGGTTTGTACATGGTCAGC
GACATCCTGTCGTCTTCGTCGACGACCGTCTTCCGACACGCTTGGAGGTTCCGAAGCCTATTCGAGAAGGCGCTG
AAGGATTTCCAGGTGTTTGAGTTCTTGGGCATCATGCCTGAGAAGCAAGGCTGGGGGCGAATGCGAGCAGAGAAG
TGGAAACGCAGCATCAGACTCGTTCTGAATTTGTGGGAAGGGTGGTGCGTGTTTCAAGGCAAGGCATTTGAGCAC
TTTGTTTCGGCGTTTGACAAGCCACCGTCGGTCAAGACGGACGACGCATCGAGCAAGGAAAAGTTGGAGGCTCGG
GCGAAGGTGGAAGCGGTGGAGCGCAAAGTGGAGGTGGTGAAGGAGCAGAAGAAGGGCAGCACGACGGGCCAAGGT
GTCGACGACGTCAAGAGAGAGAAGCCGGTGGATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail