Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2000
Gene name
LocationContig_191:24064..25506
Strand+
Gene length (bp)1442
Transcript length (bp)1164
Coding sequence length (bp)1164
Protein length (aa) 388

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00891 Methyltransf_2 O-methyltransferase domain 1.3E-11 238 356

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9P900|OMTB_ASPFL Demethylsterigmatocystin 6-O-methyltransferase OS=Aspergillus flavus GN=omtB PE=3 SV=1 46 380 1.0E-12
sp|Q9UQY0|OMTB_ASPPA Demethylsterigmatocystin 6-O-methyltransferase OS=Aspergillus parasiticus GN=omtB PE=1 SV=2 46 380 2.0E-12
sp|Q12120|OMTA_ASPPA Sterigmatocystin 8-O-methyltransferase OS=Aspergillus parasiticus GN=omtA PE=1 SV=1 43 352 1.0E-07

GO

GO Term Description Terminal node
GO:0008171 O-methyltransferase activity Yes
GO:0003674 molecular_function No
GO:0008168 methyltransferase activity No
GO:0016740 transferase activity No
GO:0003824 catalytic activity No
GO:0016741 transferase activity, transferring one-carbon groups No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

Gene cluster ID Type of secondary metabolism gene
Cluster 12 Decorating

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup30
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7767
Ophiocordyceps australis 1348a (Ghana) OphauG2|7346
Ophiocordyceps australis 1348a (Ghana) OphauG2|7110
Ophiocordyceps australis 1348a (Ghana) OphauG2|4885
Ophiocordyceps australis 1348a (Ghana) OphauG2|4306
Ophiocordyceps australis 1348a (Ghana) OphauG2|3956
Ophiocordyceps australis 1348a (Ghana) OphauG2|1539
Ophiocordyceps australis 1348a (Ghana) OphauG2|1895
Ophiocordyceps australis 1348a (Ghana) OphauG2|266
Ophiocordyceps australis map64 (Brazil) OphauB2|758
Ophiocordyceps australis map64 (Brazil) OphauB2|1462
Ophiocordyceps australis map64 (Brazil) OphauB2|2012
Ophiocordyceps australis map64 (Brazil) OphauB2|4017
Ophiocordyceps australis map64 (Brazil) OphauB2|4564
Ophiocordyceps australis map64 (Brazil) OphauB2|7299
Ophiocordyceps camponoti-rufipedis Ophun1|2861
Ophiocordyceps camponoti-rufipedis Ophun1|2000 (this protein)
Ophiocordyceps subramaniannii Hirsu2|8115
Ophiocordyceps subramaniannii Hirsu2|7926
Ophiocordyceps subramaniannii Hirsu2|6259
Ophiocordyceps subramaniannii Hirsu2|2878
Ophiocordyceps subramaniannii Hirsu2|1201
Ophiocordyceps subramaniannii Hirsu2|11082

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2000
MDFSKPNSRDANKAAVDSTLRDARKLVSLLEDFDGNSSSHEPLLEQVDKIRASLETPYNTMMNMMEKSCVSAALY
ALIRIQAFEKIPEQGSVAATDMAAECGVDVSVITHAMSILTLNGIGHESQKGHYTHNAQSRAFHPASLGGLSSLL
FDFVRGWGALPEYVKSHNPEDLYDTNKTPFASVMGLYGKTFYEVIDAIPALRAQLDSSMQETDNYISLPGLAFFT
QLEAARHCTSYGAKLILQDLPGVIASLEPAKMPGIEAMAYDMFTPQPIKDAHVYMIRRLLMDFSDEVVVQLLRII
ASAMGPKSWLVVIDTLGDEQPSPSGRYATYWGFMGLTYCGKVRSVGDFEGIFDKAGLGLFKVYRTNDSPTAILGK
LKKTSSWREILC*
Coding >Ophun1|2000
ATGGACTTCAGTAAACCCAACTCCAGAGATGCCAACAAAGCTGCCGTTGACAGTACCCTCAGAGATGCCAGAAAA
TTGGTGTCACTACTCGAGGATTTCGACGGCAATTCCAGCAGTCATGAACCCCTGCTCGAACAGGTGGACAAGATC
CGGGCCTCACTCGAGACACCATACAATACAATGATGAACATGATGGAAAAGTCTTGCGTCTCTGCGGCTTTGTAC
GCCCTTATCCGTATTCAAGCTTTCGAGAAGATACCGGAGCAGGGAAGTGTCGCTGCCACGGACATGGCAGCAGAG
TGTGGTGTAGACGTTTCCGTCATCACTCACGCTATGAGCATCCTCACTCTCAACGGTATTGGCCACGAGAGTCAG
AAGGGTCACTACACGCACAACGCACAGTCTCGAGCGTTCCATCCTGCCTCGCTCGGCGGGCTCTCCAGTCTCTTG
TTCGACTTTGTAAGGGGTTGGGGGGCTCTACCCGAATACGTCAAGTCTCACAACCCTGAGGATCTCTACGACACC
AACAAGACACCCTTTGCCTCGGTGATGGGCCTTTATGGAAAAACGTTTTATGAAGTCATCGACGCGATTCCTGCA
CTTCGCGCACAGCTTGATTCATCGATGCAAGAGACAGACAACTACATCTCCCTGCCAGGACTTGCATTCTTCACG
CAGCTCGAAGCTGCAAGGCACTGCACCTCGTACGGAGCAAAGCTTATTCTGCAAGACCTGCCTGGCGTGATTGCA
TCCCTGGAACCGGCCAAGATGCCCGGGATTGAGGCAATGGCATATGACATGTTCACTCCGCAGCCTATCAAAGAC
GCACATGTCTACATGATACGACGTCTTCTCATGGACTTCTCTGACGAGGTCGTTGTGCAATTACTTCGAATCATT
GCGTCAGCTATGGGGCCGAAGTCGTGGCTCGTCGTCATCGATACGCTGGGAGACGAGCAGCCGAGTCCAAGTGGG
CGTTATGCGACCTATTGGGGCTTTATGGGGTTGACCTACTGTGGCAAGGTGCGATCTGTGGGCGACTTCGAAGGC
ATCTTCGATAAAGCTGGACTTGGGCTCTTCAAGGTGTATCGGACCAACGACAGTCCAACTGCAATTTTGGGGAAA
CTCAAGAAGACTTCCTCGTGGCGTGAGATCTTGTGCTGA
Transcript >Ophun1|2000
ATGGACTTCAGTAAACCCAACTCCAGAGATGCCAACAAAGCTGCCGTTGACAGTACCCTCAGAGATGCCAGAAAA
TTGGTGTCACTACTCGAGGATTTCGACGGCAATTCCAGCAGTCATGAACCCCTGCTCGAACAGGTGGACAAGATC
CGGGCCTCACTCGAGACACCATACAATACAATGATGAACATGATGGAAAAGTCTTGCGTCTCTGCGGCTTTGTAC
GCCCTTATCCGTATTCAAGCTTTCGAGAAGATACCGGAGCAGGGAAGTGTCGCTGCCACGGACATGGCAGCAGAG
TGTGGTGTAGACGTTTCCGTCATCACTCACGCTATGAGCATCCTCACTCTCAACGGTATTGGCCACGAGAGTCAG
AAGGGTCACTACACGCACAACGCACAGTCTCGAGCGTTCCATCCTGCCTCGCTCGGCGGGCTCTCCAGTCTCTTG
TTCGACTTTGTAAGGGGTTGGGGGGCTCTACCCGAATACGTCAAGTCTCACAACCCTGAGGATCTCTACGACACC
AACAAGACACCCTTTGCCTCGGTGATGGGCCTTTATGGAAAAACGTTTTATGAAGTCATCGACGCGATTCCTGCA
CTTCGCGCACAGCTTGATTCATCGATGCAAGAGACAGACAACTACATCTCCCTGCCAGGACTTGCATTCTTCACG
CAGCTCGAAGCTGCAAGGCACTGCACCTCGTACGGAGCAAAGCTTATTCTGCAAGACCTGCCTGGCGTGATTGCA
TCCCTGGAACCGGCCAAGATGCCCGGGATTGAGGCAATGGCATATGACATGTTCACTCCGCAGCCTATCAAAGAC
GCACATGTCTACATGATACGACGTCTTCTCATGGACTTCTCTGACGAGGTCGTTGTGCAATTACTTCGAATCATT
GCGTCAGCTATGGGGCCGAAGTCGTGGCTCGTCGTCATCGATACGCTGGGAGACGAGCAGCCGAGTCCAAGTGGG
CGTTATGCGACCTATTGGGGCTTTATGGGGTTGACCTACTGTGGCAAGGTGCGATCTGTGGGCGACTTCGAAGGC
ATCTTCGATAAAGCTGGACTTGGGCTCTTCAAGGTGTATCGGACCAACGACAGTCCAACTGCAATTTTGGGGAAA
CTCAAGAAGACTTCCTCGTGGCGTGAGATCTTGTGCTGA
Gene >Ophun1|2000
ATGGACTTCAGTAAACCCAACTCCAGAGATGCCAACAAAGCTGCCGTTGACAGTACCCTCAGAGATGCCAGAAAA
TTGGTGTCACTACTCGAGGATTTCGACGGCAATTCCAGCAGTCATGAACCCCTGCTCGAACAGGTGGACAAGATC
CGGGCCTCACTCGAGACACCATACAATACAATGATGAACATGATGGAAAAGTCTTGCGTCTCTGCGGCTTTGTAC
GCCCTTATCCGTATTCAAGCTTTCGAGAAGATACCGGAGCAGGGAAGTGTCGCTGCCACGGACATGGCAGCAGAG
TGTGGTGTAGACGTTTCCGTCATCACTCACGCTATGAGCATCCTCACTCTCAACGGTATTGGCCACGAGAGTCAG
AAGGGTCACTACACGCACAACGCACAGTCTCGAGCGTTCCATCCTGCCTCGCTCGGCGGGCTCTCCAGTCTCTTG
TTCGACTTTGTAAGGGGTTGGGGGGCTCTACCCGAATACGTCAAGTCTCACAACCCTGAGGATCTCTACGACACC
AACAAGACACCCTTTGCCTCGGTGATGGGCCTTTATGGAAAAACGTTTTATGAAGTCATCGACGCGATTCCTGCA
CTTCGCGCACAGCTTGATTCATCGATGCAAGAGACAGACAACTACATCTCCCTGCCAGGACTTGCATTCTTCACG
CAGCTCGAAGCTGCAGTGAGAGAAGAACCGCGGCGTCCATTCATTGTTGATGTAGGTGGCGGGAGAGGACAGACG
CTATCGGCGATACAGAGGCACTGCACCTCGTACGGAGCAAAGCTTATTCTGCAAGACCTGCCTGGCGTGATTGCA
TCCCTGGAACCGGCCAAGATGCCCGGGATTGAGGCAATGGCATATGACATGTTCACTCCGCAGCCTATCAAAGGT
ATGTATTCATGAGACTTCACGCAACCCTGACATCTCTTGGCTGCCGCGCATGAAAAGGCTAATGGGCACTGCATC
TCATAGACGCACATGTCTACATGATACGACGTCTTCTCATGGACTTCTCTGACGAGGTCGTTGTGCAATTACTTC
GAATCATTGCGTCAGCTATGGGGCCGAAGTCGTGGCTCGTCGTCATCGATACGCTGGGAGACGAGCAGCCGAGTC
CAAGTGGGCGTTATGCGACCTATTGGGGCTTTATGGGGTTGACCTACTGTGGCAAGGTGCGATCTGTGGGCGACT
TCGAAGGCATCTTCGATAAAGCTGGACTTGGGCTCTTCAAGGTGTATCGGACCAACGACAGTCCAACTGCAATGT
TAGTATCGCAGCTGAGAAGATGAGGAAGGGTCTAATTCCCAAGATCTGTTTGCCTTCATACCTACCCTCTTCCGA
TGCATCAACGGACAGGACACTCCGTTATGGCTCCAGTTTATAGTTTGGGGAAACTCAAGAAGACTTCCTCGTGGC
GTGAGATCTTGTGCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail