Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2
Gene name
LocationContig_1:6187..7573
Strand+
Gene length (bp)1386
Transcript length (bp)1386
Coding sequence length (bp)1386
Protein length (aa) 462

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF20222 DUF6581 Family of unknown function (DUF6581) 3.7E-103 1 401

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup378
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7576
Ophiocordyceps australis map64 (Brazil) OphauB2|3739
Ophiocordyceps camponoti-floridani Ophcf2|04740
Ophiocordyceps camponoti-floridani Ophcf2|04741
Ophiocordyceps camponoti-rufipedis Ophun1|1
Ophiocordyceps camponoti-rufipedis Ophun1|2 (this protein)
Ophiocordyceps kimflemingae Ophio5|4150
Ophiocordyceps kimflemingae Ophio5|4151
Ophiocordyceps subramaniannii Hirsu2|1081

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2
MAAFVAVRAVLGGVDKAVDWGLLVTLYPNIGLAGLRRFWSDARKQQSAYIALFTRVFQEKLVTALESDEIPMVNF
EKPRDYDWQMLINWTMQLPRREGFQLPRSRELLGEHFTLEQVSALEEDWREKFFHSGSSFFARLEAFASEPAAIP
VGEEPECVRRPSDVDDVVVARSWIRSLLSTASTSHSIQTIRDKFLQLSPEDNHRRSGLFKTAVTQLAQERVIRRS
RKPRAGHQPYRLSEWYESQLTRMAQTSKYDAAAVFKERLDGAFRKQETFEVPYSLDEGAMMALTNMNAMGRIRLI
PVGMPDIPYGFRPGHYESRKYPKSLYHFTLQVAPTDAYQYNEDIKLLRAVITESPPLEGSRGELPQWADFLQECR
VKRWSEILGAFNFAFATRGCMTIPGVCSALHPLLEEFEARLVVEWGKRTGVLTEVMDGVGIMVAEWWWLAVPWLR
RQRGPAESKPS*
Coding >Ophun1|2
ATGGCTGCCTTCGTAGCTGTTCGTGCCGTACTTGGAGGGGTTGACAAGGCCGTTGATTGGGGCCTCCTTGTGACC
CTTTACCCGAACATTGGGCTCGCTGGCCTGCGGAGATTCTGGTCAGATGCACGCAAGCAACAAAGCGCGTACATT
GCACTCTTCACCCGGGTGTTTCAGGAGAAGCTTGTCACTGCTCTGGAGAGCGACGAGATTCCCATGGTTAATTTT
GAGAAGCCTCGAGACTATGACTGGCAGATGCTGATCAATTGGACTATGCAATTACCGCGACGGGAGGGCTTCCAG
CTGCCCAGGTCCAGAGAGTTACTCGGGGAGCACTTCACTCTGGAACAAGTCAGCGCCTTGGAAGAAGACTGGAGG
GAAAAGTTCTTCCACAGCGGATCGTCGTTCTTCGCTCGTCTCGAGGCCTTCGCGTCAGAACCGGCTGCAATCCCC
GTTGGGGAGGAGCCCGAATGTGTTCGCCGGCCGTCCGACGTGGACGACGTAGTGGTTGCCCGGTCGTGGATAAGG
AGCTTGCTATCCACGGCATCGACTTCTCACTCTATCCAAACCATCAGAGACAAGTTCCTCCAATTGTCACCCGAG
GACAACCATCGACGATCCGGCCTCTTCAAGACGGCCGTGACGCAGCTGGCGCAAGAGCGTGTGATACGCCGGAGC
CGGAAGCCCCGAGCGGGACATCAACCGTATCGACTGAGCGAATGGTATGAATCGCAATTGACGCGGATGGCGCAG
ACCTCCAAGTACGACGCAGCGGCGGTCTTCAAGGAGCGGCTCGACGGCGCGTTTCGCAAGCAGGAGACCTTTGAG
GTACCGTATTCGTTGGATGAAGGCGCCATGATGGCCTTGACCAACATGAATGCCATGGGACGAATTCGCTTGATA
CCTGTGGGGATGCCCGACATCCCATACGGCTTTAGACCGGGTCACTACGAGAGCCGAAAATACCCGAAATCGCTA
TATCACTTCACACTGCAGGTAGCGCCCACCGACGCATATCAGTACAATGAAGATATCAAGCTGCTTCGCGCGGTT
ATTACTGAGAGCCCGCCCCTGGAGGGTTCACGGGGCGAGCTGCCTCAGTGGGCCGACTTCCTCCAAGAGTGCAGA
GTGAAACGATGGTCCGAGATTCTGGGAGCTTTCAACTTCGCCTTCGCCACTCGAGGATGCATGACGATACCAGGG
GTCTGCAGCGCTCTCCATCCCCTCTTGGAGGAGTTTGAGGCTCGACTCGTGGTAGAATGGGGAAAGCGGACAGGG
GTCCTGACCGAGGTGATGGATGGCGTGGGCATCATGGTGGCGGAGTGGTGGTGGCTGGCAGTTCCGTGGCTGCGA
CGACAGAGGGGGCCTGCCGAGAGCAAGCCATCATGA
Transcript >Ophun1|2
ATGGCTGCCTTCGTAGCTGTTCGTGCCGTACTTGGAGGGGTTGACAAGGCCGTTGATTGGGGCCTCCTTGTGACC
CTTTACCCGAACATTGGGCTCGCTGGCCTGCGGAGATTCTGGTCAGATGCACGCAAGCAACAAAGCGCGTACATT
GCACTCTTCACCCGGGTGTTTCAGGAGAAGCTTGTCACTGCTCTGGAGAGCGACGAGATTCCCATGGTTAATTTT
GAGAAGCCTCGAGACTATGACTGGCAGATGCTGATCAATTGGACTATGCAATTACCGCGACGGGAGGGCTTCCAG
CTGCCCAGGTCCAGAGAGTTACTCGGGGAGCACTTCACTCTGGAACAAGTCAGCGCCTTGGAAGAAGACTGGAGG
GAAAAGTTCTTCCACAGCGGATCGTCGTTCTTCGCTCGTCTCGAGGCCTTCGCGTCAGAACCGGCTGCAATCCCC
GTTGGGGAGGAGCCCGAATGTGTTCGCCGGCCGTCCGACGTGGACGACGTAGTGGTTGCCCGGTCGTGGATAAGG
AGCTTGCTATCCACGGCATCGACTTCTCACTCTATCCAAACCATCAGAGACAAGTTCCTCCAATTGTCACCCGAG
GACAACCATCGACGATCCGGCCTCTTCAAGACGGCCGTGACGCAGCTGGCGCAAGAGCGTGTGATACGCCGGAGC
CGGAAGCCCCGAGCGGGACATCAACCGTATCGACTGAGCGAATGGTATGAATCGCAATTGACGCGGATGGCGCAG
ACCTCCAAGTACGACGCAGCGGCGGTCTTCAAGGAGCGGCTCGACGGCGCGTTTCGCAAGCAGGAGACCTTTGAG
GTACCGTATTCGTTGGATGAAGGCGCCATGATGGCCTTGACCAACATGAATGCCATGGGACGAATTCGCTTGATA
CCTGTGGGGATGCCCGACATCCCATACGGCTTTAGACCGGGTCACTACGAGAGCCGAAAATACCCGAAATCGCTA
TATCACTTCACACTGCAGGTAGCGCCCACCGACGCATATCAGTACAATGAAGATATCAAGCTGCTTCGCGCGGTT
ATTACTGAGAGCCCGCCCCTGGAGGGTTCACGGGGCGAGCTGCCTCAGTGGGCCGACTTCCTCCAAGAGTGCAGA
GTGAAACGATGGTCCGAGATTCTGGGAGCTTTCAACTTCGCCTTCGCCACTCGAGGATGCATGACGATACCAGGG
GTCTGCAGCGCTCTCCATCCCCTCTTGGAGGAGTTTGAGGCTCGACTCGTGGTAGAATGGGGAAAGCGGACAGGG
GTCCTGACCGAGGTGATGGATGGCGTGGGCATCATGGTGGCGGAGTGGTGGTGGCTGGCAGTTCCGTGGCTGCGA
CGACAGAGGGGGCCTGCCGAGAGCAAGCCATCATGA
Gene >Ophun1|2
ATGGCTGCCTTCGTAGCTGTTCGTGCCGTACTTGGAGGGGTTGACAAGGCCGTTGATTGGGGCCTCCTTGTGACC
CTTTACCCGAACATTGGGCTCGCTGGCCTGCGGAGATTCTGGTCAGATGCACGCAAGCAACAAAGCGCGTACATT
GCACTCTTCACCCGGGTGTTTCAGGAGAAGCTTGTCACTGCTCTGGAGAGCGACGAGATTCCCATGGTTAATTTT
GAGAAGCCTCGAGACTATGACTGGCAGATGCTGATCAATTGGACTATGCAATTACCGCGACGGGAGGGCTTCCAG
CTGCCCAGGTCCAGAGAGTTACTCGGGGAGCACTTCACTCTGGAACAAGTCAGCGCCTTGGAAGAAGACTGGAGG
GAAAAGTTCTTCCACAGCGGATCGTCGTTCTTCGCTCGTCTCGAGGCCTTCGCGTCAGAACCGGCTGCAATCCCC
GTTGGGGAGGAGCCCGAATGTGTTCGCCGGCCGTCCGACGTGGACGACGTAGTGGTTGCCCGGTCGTGGATAAGG
AGCTTGCTATCCACGGCATCGACTTCTCACTCTATCCAAACCATCAGAGACAAGTTCCTCCAATTGTCACCCGAG
GACAACCATCGACGATCCGGCCTCTTCAAGACGGCCGTGACGCAGCTGGCGCAAGAGCGTGTGATACGCCGGAGC
CGGAAGCCCCGAGCGGGACATCAACCGTATCGACTGAGCGAATGGTATGAATCGCAATTGACGCGGATGGCGCAG
ACCTCCAAGTACGACGCAGCGGCGGTCTTCAAGGAGCGGCTCGACGGCGCGTTTCGCAAGCAGGAGACCTTTGAG
GTACCGTATTCGTTGGATGAAGGCGCCATGATGGCCTTGACCAACATGAATGCCATGGGACGAATTCGCTTGATA
CCTGTGGGGATGCCCGACATCCCATACGGCTTTAGACCGGGTCACTACGAGAGCCGAAAATACCCGAAATCGCTA
TATCACTTCACACTGCAGGTAGCGCCCACCGACGCATATCAGTACAATGAAGATATCAAGCTGCTTCGCGCGGTT
ATTACTGAGAGCCCGCCCCTGGAGGGTTCACGGGGCGAGCTGCCTCAGTGGGCCGACTTCCTCCAAGAGTGCAGA
GTGAAACGATGGTCCGAGATTCTGGGAGCTTTCAACTTCGCCTTCGCCACTCGAGGATGCATGACGATACCAGGG
GTCTGCAGCGCTCTCCATCCCCTCTTGGAGGAGTTTGAGGCTCGACTCGTGGTAGAATGGGGAAAGCGGACAGGG
GTCCTGACCGAGGTGATGGATGGCGTGGGCATCATGGTGGCGGAGTGGTGGTGGCTGGCAGTTCCGTGGCTGCGA
CGACAGAGGGGGCCTGCCGAGAGCAAGCCATCATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail