Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1999
Gene name
LocationContig_191:22344..23313
Strand+
Gene length (bp)969
Transcript length (bp)969
Coding sequence length (bp)969
Protein length (aa) 323

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05368 NmrA NmrA-like family 5.8E-17 12 240
PF13460 NAD_binding_10 NAD(P)H-binding 4.6E-12 15 178

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 34 0.5

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1999
MTATNEPIKKVCLIGANGLVGSVILDYLLKAATFDVSILRRTNSSSSTKAAHEHLVTEISISPELGLEELTSAFK
GQDAVILSVPLKDIDMHMRIAEAACTAGVRRFIPAEFGSDSTHPLAKEHLQLFRDKTEVREWCDKLVEKSIRAGG
CFSWTAVACGLLFDDGLREGYWFFDLNKRTARIMDGGTIRASTCTITRAAQTVVAILQRPEATPNRLAFVQSFCP
TQLEVLDALEKATGCTWTREPFESTTFLEQERRKLAAGELSLGAHVGSAGPVVSILVGQNWAAKEDFAMRPLGLE
DEVLDEVVSGVVASLEKETPTK*
Coding >Ophun1|1999
ATGACCGCCACCAACGAACCCATCAAGAAAGTCTGTCTCATCGGTGCCAACGGACTTGTTGGTTCAGTCATTCTA
GACTATCTCCTTAAAGCCGCAACGTTCGATGTCTCGATTCTCCGGCGCACCAACTCTTCCTCTTCAACTAAAGCT
GCCCATGAACATCTCGTCACCGAGATTTCCATCTCGCCTGAGCTGGGGCTCGAAGAGCTCACTTCCGCTTTCAAA
GGGCAGGATGCCGTCATTCTCTCAGTTCCTCTCAAAGACATAGATATGCATATGCGTATCGCCGAAGCAGCTTGC
ACGGCTGGCGTCCGACGCTTCATCCCAGCTGAGTTTGGCAGTGATTCTACTCACCCGCTGGCGAAAGAACATTTA
CAGCTGTTTCGTGACAAGACTGAAGTTCGGGAATGGTGTGACAAGTTGGTAGAGAAGAGCATTCGAGCAGGCGGG
TGCTTCTCCTGGACCGCTGTCGCCTGCGGCCTCCTTTTTGATGATGGCCTTCGCGAGGGTTACTGGTTCTTTGAC
CTCAACAAGAGGACGGCTCGCATCATGGACGGAGGCACTATACGCGCTTCCACTTGTACCATTACCCGTGCTGCC
CAGACAGTCGTTGCCATCTTGCAGAGACCCGAAGCAACGCCAAACCGCCTTGCCTTCGTCCAGAGTTTTTGTCCG
ACGCAGCTAGAGGTCCTTGATGCGTTGGAGAAGGCTACGGGCTGCACGTGGACTAGAGAGCCGTTCGAGTCCACC
ACGTTTCTCGAGCAGGAGCGTCGAAAGCTAGCAGCTGGAGAGCTAAGTCTGGGGGCACACGTTGGCAGTGCTGGG
CCTGTTGTTAGCATCCTAGTGGGTCAGAACTGGGCGGCCAAGGAAGACTTTGCTATGAGACCGCTGGGGTTGGAA
GACGAGGTGTTGGATGAGGTTGTGTCAGGGGTAGTGGCGTCTCTTGAGAAGGAGACGCCAACGAAGTAG
Transcript >Ophun1|1999
ATGACCGCCACCAACGAACCCATCAAGAAAGTCTGTCTCATCGGTGCCAACGGACTTGTTGGTTCAGTCATTCTA
GACTATCTCCTTAAAGCCGCAACGTTCGATGTCTCGATTCTCCGGCGCACCAACTCTTCCTCTTCAACTAAAGCT
GCCCATGAACATCTCGTCACCGAGATTTCCATCTCGCCTGAGCTGGGGCTCGAAGAGCTCACTTCCGCTTTCAAA
GGGCAGGATGCCGTCATTCTCTCAGTTCCTCTCAAAGACATAGATATGCATATGCGTATCGCCGAAGCAGCTTGC
ACGGCTGGCGTCCGACGCTTCATCCCAGCTGAGTTTGGCAGTGATTCTACTCACCCGCTGGCGAAAGAACATTTA
CAGCTGTTTCGTGACAAGACTGAAGTTCGGGAATGGTGTGACAAGTTGGTAGAGAAGAGCATTCGAGCAGGCGGG
TGCTTCTCCTGGACCGCTGTCGCCTGCGGCCTCCTTTTTGATGATGGCCTTCGCGAGGGTTACTGGTTCTTTGAC
CTCAACAAGAGGACGGCTCGCATCATGGACGGAGGCACTATACGCGCTTCCACTTGTACCATTACCCGTGCTGCC
CAGACAGTCGTTGCCATCTTGCAGAGACCCGAAGCAACGCCAAACCGCCTTGCCTTCGTCCAGAGTTTTTGTCCG
ACGCAGCTAGAGGTCCTTGATGCGTTGGAGAAGGCTACGGGCTGCACGTGGACTAGAGAGCCGTTCGAGTCCACC
ACGTTTCTCGAGCAGGAGCGTCGAAAGCTAGCAGCTGGAGAGCTAAGTCTGGGGGCACACGTTGGCAGTGCTGGG
CCTGTTGTTAGCATCCTAGTGGGTCAGAACTGGGCGGCCAAGGAAGACTTTGCTATGAGACCGCTGGGGTTGGAA
GACGAGGTGTTGGATGAGGTTGTGTCAGGGGTAGTGGCGTCTCTTGAGAAGGAGACGCCAACGAAGTAG
Gene >Ophun1|1999
ATGACCGCCACCAACGAACCCATCAAGAAAGTCTGTCTCATCGGTGCCAACGGACTTGTTGGTTCAGTCATTCTA
GACTATCTCCTTAAAGCCGCAACGTTCGATGTCTCGATTCTCCGGCGCACCAACTCTTCCTCTTCAACTAAAGCT
GCCCATGAACATCTCGTCACCGAGATTTCCATCTCGCCTGAGCTGGGGCTCGAAGAGCTCACTTCCGCTTTCAAA
GGGCAGGATGCCGTCATTCTCTCAGTTCCTCTCAAAGACATAGATATGCATATGCGTATCGCCGAAGCAGCTTGC
ACGGCTGGCGTCCGACGCTTCATCCCAGCTGAGTTTGGCAGTGATTCTACTCACCCGCTGGCGAAAGAACATTTA
CAGCTGTTTCGTGACAAGACTGAAGTTCGGGAATGGTGTGACAAGTTGGTAGAGAAGAGCATTCGAGCAGGCGGG
TGCTTCTCCTGGACCGCTGTCGCCTGCGGCCTCCTTTTTGATGATGGCCTTCGCGAGGGTTACTGGTTCTTTGAC
CTCAACAAGAGGACGGCTCGCATCATGGACGGAGGCACTATACGCGCTTCCACTTGTACCATTACCCGTGCTGCC
CAGACAGTCGTTGCCATCTTGCAGAGACCCGAAGCAACGCCAAACCGCCTTGCCTTCGTCCAGAGTTTTTGTCCG
ACGCAGCTAGAGGTCCTTGATGCGTTGGAGAAGGCTACGGGCTGCACGTGGACTAGAGAGCCGTTCGAGTCCACC
ACGTTTCTCGAGCAGGAGCGTCGAAAGCTAGCAGCTGGAGAGCTAAGTCTGGGGGCACACGTTGGCAGTGCTGGG
CCTGTTGTTAGCATCCTAGTGGGTCAGAACTGGGCGGCCAAGGAAGACTTTGCTATGAGACCGCTGGGGTTGGAA
GACGAGGTGTTGGATGAGGTTGTGTCAGGGGTAGTGGCGTCTCTTGAGAAGGAGACGCCAACGAAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail